KEGG   Myxococcus fulvus: LILAB_17050Help
Entry
LILAB_17050       CDS       T01558                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00071  Fatty acid degradation
mfu00280  Valine, leucine and isoleucine degradation
mfu00281  Geraniol degradation
mfu00310  Lysine degradation
mfu00360  Phenylalanine metabolism
mfu00362  Benzoate degradation
mfu00380  Tryptophan metabolism
mfu00410  beta-Alanine metabolism
mfu00627  Aminobenzoate degradation
mfu00640  Propanoate metabolism
mfu00650  Butanoate metabolism
mfu00903  Limonene and pinene degradation
mfu00930  Caprolactam degradation
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01212  Fatty acid metabolism
Module
mfu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LILAB_17050
   00650 Butanoate metabolism
    LILAB_17050
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_17050
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_17050
   00310 Lysine degradation
    LILAB_17050
   00360 Phenylalanine metabolism
    LILAB_17050
   00380 Tryptophan metabolism
    LILAB_17050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LILAB_17050
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LILAB_17050
   00281 Geraniol degradation
    LILAB_17050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LILAB_17050
   00627 Aminobenzoate degradation
    LILAB_17050
   00930 Caprolactam degradation
    LILAB_17050
Enzymes [BR:mfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LILAB_17050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEI65313
UniProt: F8CMN4
Position
4021105..4021932
Genome map
AA seq 275 aa AA seqDB search
MDGTYKSLRIEKNEGVAELVLTGPGKGNAMGPDFWREMPEAIRALDADDAVRVVLVRGEG
KHFTFGLDLVGMMESLGPLLTGEGNLAQERLKLLALIGDMQQATEGLARCRKPVIAAVHG
WCIGGGMDLIAACDFRYCSQDAKFSLREVKVGIVADLGALQRLPRIIGDGNTRELAYTGG
DIDSARALRMGLVNDVFPTPEALLEEARATAKRIAENPPLVVQGAKQVMEYCADKSIADG
LRYVAVWNSAFLQSHDLAEAFSAFMERRAPRFQGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggacgggacctacaagtcgctgcgcatcgagaagaacgaaggcgtcgccgagctggtg
ctcaccggccccggcaagggcaacgccatgggccctgacttctggcgcgagatgcccgag
gccatccgcgcgctggacgcggatgacgccgttcgcgtcgtgctcgttcgcggagagggc
aagcacttcaccttcggcctggacctcgtggggatgatggagtccctggggccgctgctc
acgggggagggcaacctggcccaggagcgcttgaagctgctggccctcattggcgacatg
cagcaggctaccgagggcctggcccgctgtcgcaagcccgtcatcgccgccgtgcatggc
tggtgcatcggcggcggcatggacctcatcgccgcgtgtgacttccgctactgctcccag
gacgcgaagttctccctgcgcgaggtgaaggtcggcatcgtggccgacctgggcgcgctc
cagcggctgcctcgcatcatcggcgacggcaacacgcgcgagctggcctacaccggcggc
gacatcgactcggcgcgcgcgctccgcatggggctggtgaacgacgtgttccccacgcca
gaggccctgctggaggaggcccgggcgaccgcgaagcgcatcgcggagaatcccccgctc
gtcgtccagggcgccaagcaggtcatggagtactgcgcggacaaatccatcgcggatggc
ctgcgttatgtggcggtatggaactccgcgttcctccagtcccatgacctggccgaagcc
ttctccgcattcatggaacgccgggcccctcggttccaggggcgctga

DBGET integrated database retrieval system