KEGG   Myxococcus fulvus: LILAB_18960Help
Entry
LILAB_18960       CDS       T01558                                 

Definition
putative arginine kinase
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
mfu  Myxococcus fulvus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LILAB_18960
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     LILAB_18960
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LILAB_18960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4466686..4467711)
Genome map
AA seq 341 aa AA seqDB search
MLLHKHLTPELKARLDTLTTRHGWTLRKTIQSGLDHEDSQMGVYAGDSESYALFSPLLHP
IIREHSGHDLSGQSSDFSLDGLPRDDLDPSGEFILSTRIRVGRNLARYAFPPAIGARDRA
ALEAEVVQVLSRLPGALAGEYHPLASLSEARREELVRRHILFQQADRFLDSAGVNRDWPR
NRGLFHSADKRFIVWVGEEDALRIISMQPGSGLAAAFLRLKEALGQLDAHLDFARDSRLG
FLTACPTNLGTAMRASVLIRLPYLSRRPDFHARCARLGLSVRGLHGEHSEPHDGIHDVSN
AVRLGVTERDIYQRLRAGVQALMALEADARAAAARQRSRAG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcacaagcacctcacgcccgaactgaaagcccggctggacacgctcacgacg
cgccacggatggacgctgcggaagaccatccagagcggcctggaccacgaggactctcaa
atgggcgtctacgcgggtgacagcgagtcctacgccctgttctcaccgctgctgcatccc
atcatccgggagcactccggccatgacctgagcggacagagcagtgacttctcgctcgac
gggctgccgcgggacgacctggacccctcgggcgagttcatcctctccacgcggatccgc
gtcggcaggaacctggcccggtatgcctttcctcccgccattggcgcccgcgacagggcg
gcgctggaggccgaggtcgtccaggtcctctcgcgcctcccgggggcactggcgggcgaa
taccaccccctggccagcctctccgaggcgcggcgggaggagctggtgcggcgccacatc
ctcttccagcaggcggaccgcttcctggacagcgcgggcgtcaaccgcgactggcctcgc
aaccgggggctgttccactccgcggacaagcgcttcatcgtctgggtcggcgaggaggac
gccctgcgcatcatcagcatgcagcccgggtccgggctcgcggcggccttcctccggctc
aaggaggcgctcggtcagctcgacgcgcacctcgacttcgcccgggactcccggctgggc
ttcctcacggcctgccccaccaacctggggacggccatgcgcgcctcggtgctcatccgg
ttgccatacctgtcacgacggccggacttccacgcgcgctgcgcgcggctggggctgtcc
gtccgggggctgcacggcgagcactccgagccccatgacggcatccacgacgtgtccaac
gccgtgcggctgggcgtgacggagcgggacatctaccagcggctccgcgcgggcgtccaa
gcgctcatggcgctggaagcagacgcgcgggccgccgcggcgcgccagcgctcccgcgca
ggctga

DBGET integrated database retrieval system