KEGG   Myxococcus fulvus: LILAB_19560Help
Entry
LILAB_19560       CDS       T01558                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_19560
   01230 Biosynthesis of amino acids
    LILAB_19560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_19560
   00030 Pentose phosphate pathway
    LILAB_19560
   00051 Fructose and mannose metabolism
    LILAB_19560
   00052 Galactose metabolism
    LILAB_19560
  Energy metabolism
   00680 Methane metabolism
    LILAB_19560
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LILAB_19560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4620197..4621144
Genome map
AA seq 315 aa AA seqDB search
MPHIVTLTLNPAIDVATSVPEVTPEHKLRCGPVRRDPGGGGINVARVVRELGGDAIAVYT
RGGATGSLLEELLEEKGLLRRSVALQGATRESFTVAEGSGAREYRFILPGPTLSEPEWQR
CLDALEDVAVGAAFIVASGSLAPGVPEDFYARVARLAKRLGVRVVVDTSGAPLRAALEEG
VFMAKPNRRELRDLSGVSTEDFATQAAAARELVARGRAEVLAVSMGAEGALVTTSTAQFR
AAPPPVETRSSVGAGDSFVAGMTLALTRGQSPEDALRWGIASGTAALLTQGTDLCLRADV
ERLLPLVKSEPVPRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccccacatcgtcacgctgacgctcaaccccgccatcgacgtggccacgtccgtgccg
gaggtgactccggagcacaagctgcgctgcggccccgtgcgcagggaccccggtgggggc
ggcatcaacgtggcgcgcgtggtgcgggagctgggcggcgacgccatcgccgtctacacg
cggggcggcgccacggggagcctgctggaagagctcctggaggagaagggcctgctgcgc
cgctccgtcgcgttgcagggcgccacgcgggagagcttcacggtggcggagggctcgggg
gcgcgcgagtaccgcttcatcctgccggggcccacgttgtccgagcccgagtggcagcgc
tgcctcgacgcgctggaggacgtggccgtgggggcggccttcatcgtcgccagcggcagc
ctggcgcccggcgtgccggaggacttctatgcccgcgtggcccggctggcgaagcgcctg
ggcgtgcgcgtggtggtggacaccagcggggctccgctgcgcgcggcgttggaggagggc
gtgttcatggccaagcccaaccgccgcgagctgcgtgacttgagcggcgtgtcgacggag
gacttcgccacccaggcggccgcggcgcgtgagctggtggcgcggggccgcgccgaggtg
ctggcggtgtccatgggcgcggagggcgccctggtgacgacgtccaccgcccagttccgg
gcggcgccgccgccggtggagacgcgcagctcggtgggggcgggggacagcttcgtcgcg
gggatgacgctcgcgctcacccggggccagtcccccgaggacgcgctgcgctggggcatc
gccagcggcacggccgcgctgctcacccagggcacggacctgtgtctccgggcggacgtg
gagcggctcctccccctggtgaagtcggagcccgtccctcgtccgtag

DBGET integrated database retrieval system