KEGG   Myxococcus fulvus: LILAB_19560Help
Entry
LILAB_19560       CDS       T01558                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00030  Pentose phosphate pathway
mfu00051  Fructose and mannose metabolism
mfu00052  Galactose metabolism
mfu00680  Methane metabolism
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
mfu01230  Biosynthesis of amino acids
Module
mfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_19560
   00030 Pentose phosphate pathway
    LILAB_19560
   00051 Fructose and mannose metabolism
    LILAB_19560
   00052 Galactose metabolism
    LILAB_19560
  Energy metabolism
   00680 Methane metabolism
    LILAB_19560
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LILAB_19560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AEI65814
UniProt: F8CAF6
Position
4620197..4621144
Genome map
AA seq 315 aa AA seqDB search
MPHIVTLTLNPAIDVATSVPEVTPEHKLRCGPVRRDPGGGGINVARVVRELGGDAIAVYT
RGGATGSLLEELLEEKGLLRRSVALQGATRESFTVAEGSGAREYRFILPGPTLSEPEWQR
CLDALEDVAVGAAFIVASGSLAPGVPEDFYARVARLAKRLGVRVVVDTSGAPLRAALEEG
VFMAKPNRRELRDLSGVSTEDFATQAAAARELVARGRAEVLAVSMGAEGALVTTSTAQFR
AAPPPVETRSSVGAGDSFVAGMTLALTRGQSPEDALRWGIASGTAALLTQGTDLCLRADV
ERLLPLVKSEPVPRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccccacatcgtcacgctgacgctcaaccccgccatcgacgtggccacgtccgtgccg
gaggtgactccggagcacaagctgcgctgcggccccgtgcgcagggaccccggtgggggc
ggcatcaacgtggcgcgcgtggtgcgggagctgggcggcgacgccatcgccgtctacacg
cggggcggcgccacggggagcctgctggaagagctcctggaggagaagggcctgctgcgc
cgctccgtcgcgttgcagggcgccacgcgggagagcttcacggtggcggagggctcgggg
gcgcgcgagtaccgcttcatcctgccggggcccacgttgtccgagcccgagtggcagcgc
tgcctcgacgcgctggaggacgtggccgtgggggcggccttcatcgtcgccagcggcagc
ctggcgcccggcgtgccggaggacttctatgcccgcgtggcccggctggcgaagcgcctg
ggcgtgcgcgtggtggtggacaccagcggggctccgctgcgcgcggcgttggaggagggc
gtgttcatggccaagcccaaccgccgcgagctgcgtgacttgagcggcgtgtcgacggag
gacttcgccacccaggcggccgcggcgcgtgagctggtggcgcggggccgcgccgaggtg
ctggcggtgtccatgggcgcggagggcgccctggtgacgacgtccaccgcccagttccgg
gcggcgccgccgccggtggagacgcgcagctcggtgggggcgggggacagcttcgtcgcg
gggatgacgctcgcgctcacccggggccagtcccccgaggacgcgctgcgctggggcatc
gccagcggcacggccgcgctgctcacccagggcacggacctgtgtctccgggcggacgtg
gagcggctcctccccctggtgaagtcggagcccgtccctcgtccgtag

DBGET integrated database retrieval system