KEGG   Myxococcus fulvus: LILAB_19635Help
Entry
LILAB_19635       CDS       T01558                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mfu  Myxococcus fulvus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LILAB_19635
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LILAB_19635
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LILAB_19635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4640747..4641316
Genome map
AA seq 189 aa AA seqDB search
MTLASALAFTPAWAAAPKPSPAKSESTSEKKPMSFHDLTANRLDGKPEKLSNYQGKVVLV
VNTASECGYTPQYAGLEKLHQDYKDKGLVVVGFPSNDFGGQEPGSSEDIKKFCELRYKVT
FPMFEKVKTKGDGQSPVYAFLSQHHPAPKWNFHKFVVGKDGQVKAGFPSAVTPDSAELKA
AIDSALAQP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgaccctggcctcggcgctggccttcacccccgcgtgggccgcggcgccgaagccgtcc
cccgcgaagtccgaatccacgagcgagaagaagcccatgtccttccatgacctcaccgcg
aaccggctcgacggcaagccggagaagctgtccaactaccagggcaaggtcgtcctggtg
gtgaacaccgcgtccgaatgtggctacacgccgcagtacgcgggcctggagaagctccac
caggactacaaggacaagggcctggtggtggtgggcttcccgtccaatgacttcggcggc
caggagccgggctcgtcggaggacatcaagaagttctgcgagctgcgctacaaggtcacc
ttccccatgttcgagaaggtgaagacgaagggggacggccagtcgcccgtctacgcgttc
ctgtctcagcaccaccccgcgcccaagtggaacttccacaagttcgtggtgggcaaggac
gggcaggtgaaggcgggcttccccagcgcggtgacgccggacagcgccgagctgaaggcg
gccatcgacagcgcgctcgcgcagccgtag

DBGET integrated database retrieval system