KEGG   Myxococcus fulvus: LILAB_20525Help
Entry
LILAB_20525       CDS       T01558                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mfu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mfu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mfu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4842263..4844239
Genome map
AA seq 658 aa AA seqDB search
MSTLEERMADSKHEIHSVLTEARVFPPPEAFAQRAHIRSMAQYQQLWDEAARDPDRYWGE
RAREELYWKEPFQTVLDWKPPHARWFVEGKTNLAYNCLDRHLATRGDKPAILFEGEPGDR
RSVTFAELAAEVNKLANALKSLGVRKGDRVGIYLPMVPEAAVAMLACARIGAVHSVVFGG
FSAEALQERMNDAGAKVLLTADGGWRKGAVVPLLKNVEAALPHMASMEKVVVLRRTGDAL
ALSGPKLVAWDTLVNGQSAECAPEWVESEHPLFILYTSGSTGKPKGVLHTTGGYAVGASL
TTRWVFDLRDDDVYWCTADVGWVTGHTYVVYGPLMNGVTTVLYEGAPTQPGPDRFWDIIE
RYKATILYTAPTAIRAFMRLGEEPVRKHDLSSLRLLGSVGEPINPEAWMWYRDVIGGGRC
PVVDTWWQTETGGIMVSPLPGATPTKPGSATLPLPGIHAEILDREGNKVPRGQGGLLFVT
RPWPSMLRTVYGDPDRYVRTYFNELPGMYFTGDGARTDADGYLWLMGRVDDVVNVAGHRL
GTAEVESALVSHETVAEAAVVGRPDDLKGTALVAFVTLKQGNTPSDALKKTLASHVGREI
GAIARPDEIRFAEALPKTRSGKIMRRLLRDVAAGKQASGDTTTLEDLNVLAALRQNDD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacgctggaggaacgcatggcggattcgaagcatgagattcactcggtcctgacg
gaagcacgcgtctttccgcctccagaggcgttcgcccagcgcgcgcacatccggagcatg
gcgcagtaccagcagctctgggacgaggccgccagggacccggacaggtactggggcgag
cgggcccgcgaggagctgtactggaaggagcccttccagacggtgctcgactggaagccg
ccgcacgcgcggtggttcgtcgagggcaagacgaacctggcctacaactgcctggaccgg
cacctggccacccgcggggacaagcccgcaatcctcttcgagggcgagcccggtgaccgc
cgcagcgtcacgttcgctgagctggccgccgaggtgaacaagctggccaacgcgctcaag
tcgctgggcgtgcggaagggggaccgcgtgggcatctacctgcccatggtgcccgaggcc
gcggtggccatgctggcgtgcgcgcgcatcggcgcggtgcactccgtggtgttcggcggc
ttctccgcggaggcgctccaggagcgcatgaacgacgcgggcgccaaggtgctgctcacc
gcggacggcggctggcgcaagggcgcggtggtgccgctcttgaagaacgtggaggccgcg
ctgccccacatggcctccatggagaaggtggtggtgctccgccgcacgggcgacgcgctg
gcgctgtccggccccaagctggtggcgtgggacacgctggtgaacggccagtccgcggag
tgtgcgccggagtgggtggagagcgagcacccgctgttcatcctctacacgtcgggctcc
accgggaagcccaagggcgtgctgcacaccacgggcggctacgcggtgggcgcgtcgctc
accacgcgctgggtgttcgacctgcgcgacgacgacgtctactggtgcaccgccgacgtg
ggctgggtgacggggcacacgtacgtcgtctacggcccgctgatgaacggcgtcaccacc
gtcctctacgagggcgcgcccacccagccggggccggaccgcttctgggacatcatcgag
cggtacaaggccaccatcctctacaccgcgcccaccgccatccgcgccttcatgcgcctg
ggcgaggagcccgtgcgcaagcatgacctgtcctcgctgcgcctgctgggcagcgtgggc
gagcccatcaaccccgaggcgtggatgtggtaccgcgacgtcatcggcggcggccgctgc
cccgtggtggacacctggtggcagacggagacgggcggcatcatggtgtcgccgctgccg
ggggccacgccgacgaagcccggctcggccacgctgccgctgcccggcatccacgcggag
attctggaccgcgagggcaacaaggtgccgcgagggcagggcggactgctcttcgtcacg
cgcccctggccctccatgctgcgcaccgtgtacggcgacccggaccgctacgtgcgcacc
tacttcaacgagctgcccggcatgtacttcaccggcgacggcgcccgcaccgacgcggac
ggctacctctggctgatgggccgcgtggatgacgtggtcaacgtcgccggccaccgcctg
ggcaccgccgaggtggagagcgcgctggtgtcccatgaaaccgtcgccgaggccgcagtg
gtgggccggccggatgacttgaagggcaccgcgctggtggccttcgtcaccttgaagcag
ggcaacacgccgtccgacgcgctgaagaagacgctggcctcccacgtgggccgcgagatt
ggcgccatcgcccggccggatgaaatccgcttcgcggaggccctgccgaagacgcgctcg
gggaagatcatgcgccggctgctgcgcgacgtggccgcgggcaagcaggcctccggggac
accaccaccctggaagacctcaacgtcctggcggccctgcggcagaacgacgactga

DBGET integrated database retrieval system