KEGG   Myxococcus fulvus: LILAB_20525Help
Entry
LILAB_20525       CDS       T01558                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00620  Pyruvate metabolism
mfu00640  Propanoate metabolism
mfu00680  Methane metabolism
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_20525
   00620 Pyruvate metabolism
    LILAB_20525
   00640 Propanoate metabolism
    LILAB_20525
  Energy metabolism
   00680 Methane metabolism
    LILAB_20525
Enzymes [BR:mfu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LILAB_20525
Lipid biosynthesis proteins [BR:mfu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LILAB_20525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEI66005
UniProt: F8CD88
Position
4842263..4844239
Genome map
AA seq 658 aa AA seqDB search
MSTLEERMADSKHEIHSVLTEARVFPPPEAFAQRAHIRSMAQYQQLWDEAARDPDRYWGE
RAREELYWKEPFQTVLDWKPPHARWFVEGKTNLAYNCLDRHLATRGDKPAILFEGEPGDR
RSVTFAELAAEVNKLANALKSLGVRKGDRVGIYLPMVPEAAVAMLACARIGAVHSVVFGG
FSAEALQERMNDAGAKVLLTADGGWRKGAVVPLLKNVEAALPHMASMEKVVVLRRTGDAL
ALSGPKLVAWDTLVNGQSAECAPEWVESEHPLFILYTSGSTGKPKGVLHTTGGYAVGASL
TTRWVFDLRDDDVYWCTADVGWVTGHTYVVYGPLMNGVTTVLYEGAPTQPGPDRFWDIIE
RYKATILYTAPTAIRAFMRLGEEPVRKHDLSSLRLLGSVGEPINPEAWMWYRDVIGGGRC
PVVDTWWQTETGGIMVSPLPGATPTKPGSATLPLPGIHAEILDREGNKVPRGQGGLLFVT
RPWPSMLRTVYGDPDRYVRTYFNELPGMYFTGDGARTDADGYLWLMGRVDDVVNVAGHRL
GTAEVESALVSHETVAEAAVVGRPDDLKGTALVAFVTLKQGNTPSDALKKTLASHVGREI
GAIARPDEIRFAEALPKTRSGKIMRRLLRDVAAGKQASGDTTTLEDLNVLAALRQNDD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacgctggaggaacgcatggcggattcgaagcatgagattcactcggtcctgacg
gaagcacgcgtctttccgcctccagaggcgttcgcccagcgcgcgcacatccggagcatg
gcgcagtaccagcagctctgggacgaggccgccagggacccggacaggtactggggcgag
cgggcccgcgaggagctgtactggaaggagcccttccagacggtgctcgactggaagccg
ccgcacgcgcggtggttcgtcgagggcaagacgaacctggcctacaactgcctggaccgg
cacctggccacccgcggggacaagcccgcaatcctcttcgagggcgagcccggtgaccgc
cgcagcgtcacgttcgctgagctggccgccgaggtgaacaagctggccaacgcgctcaag
tcgctgggcgtgcggaagggggaccgcgtgggcatctacctgcccatggtgcccgaggcc
gcggtggccatgctggcgtgcgcgcgcatcggcgcggtgcactccgtggtgttcggcggc
ttctccgcggaggcgctccaggagcgcatgaacgacgcgggcgccaaggtgctgctcacc
gcggacggcggctggcgcaagggcgcggtggtgccgctcttgaagaacgtggaggccgcg
ctgccccacatggcctccatggagaaggtggtggtgctccgccgcacgggcgacgcgctg
gcgctgtccggccccaagctggtggcgtgggacacgctggtgaacggccagtccgcggag
tgtgcgccggagtgggtggagagcgagcacccgctgttcatcctctacacgtcgggctcc
accgggaagcccaagggcgtgctgcacaccacgggcggctacgcggtgggcgcgtcgctc
accacgcgctgggtgttcgacctgcgcgacgacgacgtctactggtgcaccgccgacgtg
ggctgggtgacggggcacacgtacgtcgtctacggcccgctgatgaacggcgtcaccacc
gtcctctacgagggcgcgcccacccagccggggccggaccgcttctgggacatcatcgag
cggtacaaggccaccatcctctacaccgcgcccaccgccatccgcgccttcatgcgcctg
ggcgaggagcccgtgcgcaagcatgacctgtcctcgctgcgcctgctgggcagcgtgggc
gagcccatcaaccccgaggcgtggatgtggtaccgcgacgtcatcggcggcggccgctgc
cccgtggtggacacctggtggcagacggagacgggcggcatcatggtgtcgccgctgccg
ggggccacgccgacgaagcccggctcggccacgctgccgctgcccggcatccacgcggag
attctggaccgcgagggcaacaaggtgccgcgagggcagggcggactgctcttcgtcacg
cgcccctggccctccatgctgcgcaccgtgtacggcgacccggaccgctacgtgcgcacc
tacttcaacgagctgcccggcatgtacttcaccggcgacggcgcccgcaccgacgcggac
ggctacctctggctgatgggccgcgtggatgacgtggtcaacgtcgccggccaccgcctg
ggcaccgccgaggtggagagcgcgctggtgtcccatgaaaccgtcgccgaggccgcagtg
gtgggccggccggatgacttgaagggcaccgcgctggtggccttcgtcaccttgaagcag
ggcaacacgccgtccgacgcgctgaagaagacgctggcctcccacgtgggccgcgagatt
ggcgccatcgcccggccggatgaaatccgcttcgcggaggccctgccgaagacgcgctcg
gggaagatcatgcgccggctgctgcgcgacgtggccgcgggcaagcaggcctccggggac
accaccaccctggaagacctcaacgtcctggcggccctgcggcagaacgacgactga

DBGET integrated database retrieval system