KEGG   Myxococcus fulvus: LILAB_20965Help
Entry
LILAB_20965       CDS       T01558                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfu  Myxococcus fulvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mfu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4952554..4953294
Genome map
AA seq 246 aa AA seqDB search
MVTRPRERAEELCFLLEDEGAEVLSVPLLELHPPEDPRPLASAAEHIQRYAWVVFASPSG
VEALMEALREAGTQDRMQRVKVATVGPRTTRAAEGYGLDVVAEPAEGTGEALFNLIKDAL
QPGDEVLLPAAEEGRRELEDSLREHGVLVTRVTAYRSTPAALPPEALALLDASPPDVVLF
ASPRTAEAFLEEAGRERLATARVVAIGPTTASALERLGVPAAAVAERPTPESLVDATVLA
VTSTVH
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttggtgacgcgcccgcgtgagcgggccgaggagctgtgcttcctcctggaggacgagggc
gcggaggtgctcagcgtgcccttgttggagctgcatcctccggaggatccgcggcccctg
gcgtccgcggccgagcacatccagcgttatgcctgggtggtgttcgcgagcccgtcgggc
gtggaggcgctgatggaggcgctgcgcgaggcgggcacgcaggaccggatgcagcgggtg
aaggtggccaccgtggggccacgcacgacgcgcgccgcggagggctacgggctggacgtg
gtggccgagcccgccgagggcacgggagaggccctgttcaacctcatcaaggacgcgctg
cagccgggtgatgaggtcctgcttcccgccgccgaggagggccgcagggagctggaggac
tcgctgcgggagcatggcgttctggtgacgcgggtgacggcgtaccgctccacccccgcc
gccctgccgcccgaggcgctggccctgctggatgcgtccccgccggacgtggtgctcttc
gcctcgccgcgcacggccgaggccttcctggaagaggccggccgcgagcgcctggccacc
gcgcgcgtggtggccattggcccgacgacggcgtccgccctggagcggctgggggtgccc
gcggcggccgtcgccgagcggccgaccccggagtccctggtggacgccacggtgctcgcg
gtgacgagcacggtgcactga

DBGET integrated database retrieval system