KEGG   Myxococcus fulvus: LILAB_21790Help
Entry
LILAB_21790       CDS       T01558                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_21790
   01230 Biosynthesis of amino acids
    LILAB_21790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_21790
   00051 Fructose and mannose metabolism
    LILAB_21790
   00562 Inositol phosphate metabolism
    LILAB_21790
Enzymes [BR:mfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LILAB_21790
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LILAB_21790
  Exosomal proteins of bladder cancer cells
   LILAB_21790
  Exosomal proteins of melanoma cells
   LILAB_21790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5161144..5161869
Genome map
AA seq 241 aa AA seqDB search
MNKTVPEALALVRELRGQVASQGDTVEVVVAPPFVALQPLHVALEGAPLALAGQNCHWES
SGAFTGEISAPMLAELGCAYVIVGHSERRQYFGDTDEQVNKRAKAVRAAGMTPIICVGET
LAERDANQTLAVVERQVRGALEGFEAKDVASFVLAYEPVWAIGTGRNATAAQAQEVHAAI
RGLVGRLYDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALVGGASLKAGDFAAIVQAA
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacggtaccggaggcgttggccctggtgcgtgagctgcgaggccaggtggcc
tcccagggggacaccgtggaggtggtggtggcgccgccgttcgtggcgctgcagccgctc
catgtcgcgctggaaggcgcgccgctggcgctggcggggcagaactgccactgggagtcg
tccggcgccttcaccggggagatctccgcgcccatgctggcggagctggggtgcgcctac
gtcatcgtgggccactccgagcgccggcagtacttcggggacacggacgagcaggtgaac
aagcgggcgaaggcggtccgcgcggcggggatgacgcccatcatctgcgtcggtgagacg
ctggccgagcgcgacgcgaaccagacgctggcggtggtggagcgccaggtgcgcggggcg
ctggagggcttcgaggccaaggacgtggccagcttcgtgctggcctacgagccggtgtgg
gccattggcaccgggcgcaacgccacggcggcgcaggcgcaggaggtccacgcggcgatc
cggggcctggtcgggcggctgtatgacggggagacggccggccgggtgcgcatccagtac
ggcggcagcgtgaagccggacaacgccgcggaattgctgggccagccggacgtggatggg
gcgcttgtcgggggcgcgagcctcaaggcgggcgacttcgcggccatcgtccaggcggcc
acttag

DBGET integrated database retrieval system