KEGG   Myxococcus fulvus: LILAB_21790Help
Entry
LILAB_21790       CDS       T01558                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mfu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mfu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mfu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5161144..5161869
Genome map
AA seq 241 aa AA seqDB search
MNKTVPEALALVRELRGQVASQGDTVEVVVAPPFVALQPLHVALEGAPLALAGQNCHWES
SGAFTGEISAPMLAELGCAYVIVGHSERRQYFGDTDEQVNKRAKAVRAAGMTPIICVGET
LAERDANQTLAVVERQVRGALEGFEAKDVASFVLAYEPVWAIGTGRNATAAQAQEVHAAI
RGLVGRLYDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALVGGASLKAGDFAAIVQAA
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacggtaccggaggcgttggccctggtgcgtgagctgcgaggccaggtggcc
tcccagggggacaccgtggaggtggtggtggcgccgccgttcgtggcgctgcagccgctc
catgtcgcgctggaaggcgcgccgctggcgctggcggggcagaactgccactgggagtcg
tccggcgccttcaccggggagatctccgcgcccatgctggcggagctggggtgcgcctac
gtcatcgtgggccactccgagcgccggcagtacttcggggacacggacgagcaggtgaac
aagcgggcgaaggcggtccgcgcggcggggatgacgcccatcatctgcgtcggtgagacg
ctggccgagcgcgacgcgaaccagacgctggcggtggtggagcgccaggtgcgcggggcg
ctggagggcttcgaggccaaggacgtggccagcttcgtgctggcctacgagccggtgtgg
gccattggcaccgggcgcaacgccacggcggcgcaggcgcaggaggtccacgcggcgatc
cggggcctggtcgggcggctgtatgacggggagacggccggccgggtgcgcatccagtac
ggcggcagcgtgaagccggacaacgccgcggaattgctgggccagccggacgtggatggg
gcgcttgtcgggggcgcgagcctcaaggcgggcgacttcgcggccatcgtccaggcggcc
acttag

DBGET integrated database retrieval system