KEGG   Myxococcus fulvus: LILAB_21790Help
Entry
LILAB_21790       CDS       T01558                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00051  Fructose and mannose metabolism
mfu00562  Inositol phosphate metabolism
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
mfu01230  Biosynthesis of amino acids
Module
mfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfu_M00002  Glycolysis, core module involving three-carbon compounds
mfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_21790
   00051 Fructose and mannose metabolism
    LILAB_21790
   00562 Inositol phosphate metabolism
    LILAB_21790
Enzymes [BR:mfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LILAB_21790
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LILAB_21790
  Exosomal proteins of bladder cancer cells
   LILAB_21790
  Exosomal proteins of melanoma cells
   LILAB_21790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI66258
UniProt: F8CHE0
Position
5161144..5161869
Genome map
AA seq 241 aa AA seqDB search
MNKTVPEALALVRELRGQVASQGDTVEVVVAPPFVALQPLHVALEGAPLALAGQNCHWES
SGAFTGEISAPMLAELGCAYVIVGHSERRQYFGDTDEQVNKRAKAVRAAGMTPIICVGET
LAERDANQTLAVVERQVRGALEGFEAKDVASFVLAYEPVWAIGTGRNATAAQAQEVHAAI
RGLVGRLYDGETAGRVRIQYGGSVKPDNAAELLGQPDVDGALVGGASLKAGDFAAIVQAA
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacggtaccggaggcgttggccctggtgcgtgagctgcgaggccaggtggcc
tcccagggggacaccgtggaggtggtggtggcgccgccgttcgtggcgctgcagccgctc
catgtcgcgctggaaggcgcgccgctggcgctggcggggcagaactgccactgggagtcg
tccggcgccttcaccggggagatctccgcgcccatgctggcggagctggggtgcgcctac
gtcatcgtgggccactccgagcgccggcagtacttcggggacacggacgagcaggtgaac
aagcgggcgaaggcggtccgcgcggcggggatgacgcccatcatctgcgtcggtgagacg
ctggccgagcgcgacgcgaaccagacgctggcggtggtggagcgccaggtgcgcggggcg
ctggagggcttcgaggccaaggacgtggccagcttcgtgctggcctacgagccggtgtgg
gccattggcaccgggcgcaacgccacggcggcgcaggcgcaggaggtccacgcggcgatc
cggggcctggtcgggcggctgtatgacggggagacggccggccgggtgcgcatccagtac
ggcggcagcgtgaagccggacaacgccgcggaattgctgggccagccggacgtggatggg
gcgcttgtcgggggcgcgagcctcaaggcgggcgacttcgcggccatcgtccaggcggcc
acttag

DBGET integrated database retrieval system