KEGG   Myxococcus fulvus: LILAB_22505Help
Entry
LILAB_22505       CDS       T01558                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mfu  Myxococcus fulvus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mfu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5354252..5354809
Genome map
AA seq 185 aa AA seqDB search
MARAVADFLRAAGLNLQDVHLSETPARVAEAWTSEFLDGYGRTPEQALGEAFPVPPGSSG
ELVVVTDLRFHSMCPHHLLPLTGRAHVAYVPGKQVVGFGRLSALVDCFAHRLILQEDLAR
EVARSLARVLGSPATACIIEAEQACLRLRGDKQRDAVTHAEAYEGALRRDGPLRRELWAR
LGARR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccgtggcggacttcctgcgcgccgccggtctgaatctccaggacgtccac
ctgtcggagacgcccgcgcgcgtggccgaggcctggacctccgagttcctcgacggctac
ggccgcacgccagagcaggcgctgggggaggccttccccgtgccgcccgggtcctccggc
gagctggtggtggtgacggacctgcgcttccactccatgtgtccgcaccacctgctgccc
ctcaccgggcgggcccacgtggcctacgtgcccggcaagcaggtggtggggttcggccgg
ttgtcggcgctggtggactgcttcgcgcaccggctcatcctccaggaggacctggcgcgc
gaggtggcccgctccctggcccgggtgctgggcagcccggccaccgcgtgcatcatcgaa
gcggagcaggcgtgcctgcgcctccggggcgacaagcagcgcgacgccgtcacccacgcg
gaggcctatgaaggcgcgctgcggcgcgacggccccctgcgccgcgagctgtgggcccgg
ctgggggcccggcgatga

DBGET integrated database retrieval system