KEGG   Myxococcus fulvus: LILAB_22505Help
Entry
LILAB_22505       CDS       T01558                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mfu  Myxococcus fulvus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LILAB_22505 (folE)
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LILAB_22505 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5354252..5354809
Genome map
AA seq 185 aa AA seqDB search
MARAVADFLRAAGLNLQDVHLSETPARVAEAWTSEFLDGYGRTPEQALGEAFPVPPGSSG
ELVVVTDLRFHSMCPHHLLPLTGRAHVAYVPGKQVVGFGRLSALVDCFAHRLILQEDLAR
EVARSLARVLGSPATACIIEAEQACLRLRGDKQRDAVTHAEAYEGALRRDGPLRRELWAR
LGARR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccgtggcggacttcctgcgcgccgccggtctgaatctccaggacgtccac
ctgtcggagacgcccgcgcgcgtggccgaggcctggacctccgagttcctcgacggctac
ggccgcacgccagagcaggcgctgggggaggccttccccgtgccgcccgggtcctccggc
gagctggtggtggtgacggacctgcgcttccactccatgtgtccgcaccacctgctgccc
ctcaccgggcgggcccacgtggcctacgtgcccggcaagcaggtggtggggttcggccgg
ttgtcggcgctggtggactgcttcgcgcaccggctcatcctccaggaggacctggcgcgc
gaggtggcccgctccctggcccgggtgctgggcagcccggccaccgcgtgcatcatcgaa
gcggagcaggcgtgcctgcgcctccggggcgacaagcagcgcgacgccgtcacccacgcg
gaggcctatgaaggcgcgctgcggcgcgacggccccctgcgccgcgagctgtgggcccgg
ctgggggcccggcgatga

DBGET integrated database retrieval system