KEGG   Myxococcus fulvus: LILAB_24815Help
Entry
LILAB_24815       CDS       T01558                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mfu  Myxococcus fulvus
Brite
Enzymes [BR:mfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LILAB_24815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 RrnaAD Methyltransf_23 NodS Methyltransf_32 GCD14 MTS Methyltransf_18 DUF938
Motif
Other DBs
NCBI-ProteinID: AEI66858
UniProt: F8C6R6
Position
5873443..5874081
Genome map
AA seq 212 aa AA seqDB search
MGDWGRADYLSRHGIQDRRVLDAIARLNRADFVPEAVREEASADVPLPIGHGQTISQPYV
VALMTEALQLQGDERVLEVGTGSGYQTALLSLLCREVFTMEIVPELARSARQVLREQGFD
NVSFREGDGALGWPEHAPFDAILAAAAPIDVPLQLLAQLKPGGRMLIPVGPRGGTQQLLR
IQRSHRAGEVPQVESLLPVRFVPMTGQHPPQG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactggggaagggctgactacctgtcgcggcacggcattcaggaccggcgcgtc
ctggacgccatcgcgcggctgaaccgcgcggacttcgtgccggaggccgtgcgggaggag
gccagcgcggatgtcccgttgcccattggccatgggcagaccatcagccagccctacgtc
gtcgcgctgatgaccgaagcgctccagctccagggggacgagcgcgtcctggaggtcggc
acgggctctggctaccagacggcgctcctgtccttgctgtgccgggaggtcttcaccatg
gagatcgtccccgagctggcccggtcggcgcggcaggtgctgcgcgagcagggcttcgac
aacgtgtcgttccgcgagggagacggcgcgctgggctggcccgagcacgcgcccttcgac
gccatcctggccgccgccgcgccgatagacgtcccgctgcaactccttgcccagctcaag
ccgggcggacggatgctgattccggtgggcccgcggggaggcacccagcaactgttgcgc
atccagcgttcccaccgggctggcgaggtgccccaggtggagtccctgctgccggtgcgc
ttcgtcccgatgacagggcagcacccgccccaggggtga

DBGET integrated database retrieval system