KEGG   Myxococcus fulvus: LILAB_24825Help
Entry
LILAB_24825       CDS       T01558                                 

Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfu  Myxococcus fulvus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LILAB_24825
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LILAB_24825
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LILAB_24825
Enzymes [BR:mfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LILAB_24825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5874745..5876085
Genome map
AA seq 446 aa AA seqDB search
MSEGLASDFRAEFACSEGCDFRASLLDVVYRCPRCGGLLEVAHDVKALSAVSAAEWKRRF
EARFGSARLPDGSGVWGKREWAYPQLPVEDIISLGEGRVPLKPLPRMAAELGLAALDLKE
CGVSPTGSFKDWGMTVLVSAVKHMRARGVPLRAVACASTGDTSAALSAYCAAAGIPAVVF
LPRDKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQAVTADTGLYLANSMNSLRIEGQKM
VAVELCQDLGWEPPDWVVIPGGNLGNASALGKGFELMLSLGLITRRPRIAVAQAQRANPL
ARSFRGGFQELVPLQAEPTLASAIQIGNPVSFKRAVKVLKAFDGVVEDATESELANAAAR
ADREGTFTCPHTGVALAALEKLVARGVVARGSRVAVVSTAHGLKFADFKVGYHRGALADV
TSRYANPPVELPATLDAVKGALADLG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggggttggcttcggacttccgcgcggagttcgcgtgcagcgagggctgtgac
ttccgcgcctcgctgctggacgtggtgtaccggtgccctcgctgcggcggcctgctggag
gtcgcgcatgacgtgaaggcgctgagcgcggtgtccgcggcggagtggaagcgccggttc
gaggcgcgcttcggctcggcgcgcctgccggatggctcgggcgtgtggggcaagcgcgag
tgggcgtacccacagctcccggtggaggacatcatctcgctcggagaggggcgggtgccg
ctcaagccgctgccgcgcatggcggcggagctggggctggccgcgctggacttgaaggag
tgcggcgtctcgcccacgggcagcttcaaggactgggggatgaccgtcctggtctccgcg
gtgaagcacatgcgcgcccggggtgtcccgctgcgcgcggtggcgtgcgcctccacgggg
gacacgtccgcggcgctctccgcctactgcgcggcggcggggattccggcggtggtgttc
ctgccgcgcgacaaggtgtcgctcgcgcagctcgtgcagcccatcgcgaatggcgcgcgg
gtgctgtccttggacacggacttcgacggctgcatgaagctggtgcaggcggtgacggcg
gacacggggctgtacctggccaactcgatgaactcgctgcgcatcgagggccagaagatg
gtcgccgtggagctctgtcaggacctgggctgggagccgccggactgggtggtgattccc
ggcggcaacctgggcaacgccagcgccctgggcaagggcttcgagctgatgctgtccctg
gggctcatcacccgccggccgcgcatcgccgtggcgcaggcgcagcgggccaacccgctg
gcgcgctcgttccggggcggcttccaggagctggtgccactacaggccgagcccacgctg
gcgtcggccatccagattgggaacccggtgtccttcaagcgcgcggtgaaggtgctcaag
gccttcgacggcgtggtggaggacgccaccgagtccgagctggccaacgccgcggcgcga
gcggaccgcgagggcaccttcacctgcccgcacacgggcgtggcgctggcggcgctggag
aagctggtggcgcggggcgtggttgcccggggctcgcgcgtggcggtggtgtccaccgcg
cacggcctgaagttcgctgacttcaaggtgggctaccaccgcggcgcgctggcggacgtg
acgagccgctacgcgaacccgccggtggagctgcccgcgacgctggacgcggtgaagggc
gcgctggcggacctgggctga

DBGET integrated database retrieval system