KEGG   Myxococcus fulvus: LILAB_25035Help
Entry
LILAB_25035       CDS       T01558                                 

Definition
glucosyl hydrolase family protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mfu  Myxococcus fulvus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LILAB_25035
Enzymes [BR:mfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LILAB_25035
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LILAB_25035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5935233..5937305
Genome map
AA seq 690 aa AA seqDB search
MPSRINPPSRPATSKASSPQRAADPRAKETSAPPSAPNTAAPQRGPVKDFFDDARQTRNA
ESQRHTAALAGSRGTGAQAQARTHGSLLPEPLRSSAASVPTQPSSRPGMGAIPYDGGTTF
RVWAPNAQRLQVAGDFSNWQAVELQREPSGNFSLDVPGAKAGDQYQFVIQGKHGDWRWKG
DPRAQDVTNSTGNSIIVDHKSYQWKHDHDFRMPPWNEAVIYEMHVGTFNDEPGWGPGNWE
SAIHKLDHLKDLGINVIKMMPTAEFAADFSWGYNPAYPFAPESAYGTPDDLKRFVDEAHK
RGIGVVMDVVYNHLGPSDLPHWDFDGETYGKGGSYFYTDWRAKTPWGDTRPDYGRHEVRD
YLRDNAMMWLREYHMDGLRVDATKEIRMASGVDNPEGWQLLRDINDAVNREFPQKIVIAE
DLGGDGALTHRDGANFDSQWDAHFVHPMREALTAFSDSDRDMNAVADAIRFKYNGSALQR
VIYTESHDEVANGKQRLPSEVGGWDAGGYHAKKRSIIGAALTMTSPGIPMIFQGQEFLED
GHFQDADPLDWKKKETYAGINQAYTDLIKLRRNWNDNTAGLRGENVNVHHVNNNDKVVAF
HRWDKGGAGDDTIVVVNMGGKHLSNYDLGLPADGTWKVRFNSDWQGYSGDFGNAQSFDVG
GRWNGKDGMPASGTLNNLGPYSVLILSKDK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccggatcaacccaccgagccgtcccgccacctccaaggcctcctccccccag
cgcgccgcggatccgcgcgccaaggagacctcggctcctccctcggcgcccaacaccgcg
gccccccagcgcggcccggtgaaggacttcttcgacgacgcccgccagacgcgcaacgcg
gagtcccagcggcacaccgccgcgttggcgggaagccgtgggacgggcgcgcaggcgcag
gcgcgcacccacggcagcctgctgccggagcccctgcgctcgagcgcggcgtcggtgccc
acgcagccctccagccgccccggcatgggcgccatcccctacgacggcggcaccacgttc
cgcgtgtgggcgcccaacgcgcagcgcctgcaggtggccggcgacttcagcaactggcag
gcggtggagctgcagcgcgagcccagcggcaacttctcgctggacgtgcccggcgccaag
gcgggggaccagtaccagttcgtcatccagggcaagcacggcgattggcgctggaagggt
gacccgcgcgcgcaggacgtcaccaactccaccggcaactccatcatcgtcgaccacaag
tcgtaccagtggaagcacgaccacgacttccggatgccgccctggaacgaggcggtcatc
tacgagatgcacgtgggcaccttcaacgacgagcccggctggggccccggcaactgggag
agcgccatccacaagctggaccacctgaaggacctgggcatcaacgtcatcaagatgatg
cccacggccgagttcgcggccgacttcagttggggctacaaccccgcgtaccccttcgcg
ccggagagcgcctacggcacgccggacgacttgaagcgcttcgtcgacgaggcccacaag
cgtggcatcggcgtggtgatggacgtcgtctacaaccacctgggccccagcgacctgccg
cactgggacttcgacggcgagacgtacggcaagggcggcagctacttctacacggactgg
cgcgccaagacgccgtggggcgacacccggccggactacggccgccacgaggtccgcgac
tacctgcgcgacaacgccatgatgtggctgcgcgagtaccacatggacggcctgcgcgtg
gacgccaccaaggagatccggatggcgagcggcgtggacaacccggaagggtggcagctc
ctgcgcgacatcaacgacgccgtcaaccgcgagttcccgcagaagatcgtcatcgccgag
gacctgggcggcgacggggccctcacgcaccgggatggcgcgaacttcgacagccagtgg
gacgcccacttcgtccacccgatgcgtgaggcgctgacggcgttctccgacagcgaccgg
gacatgaacgccgtcgcggacgccatccgcttcaagtacaacggcagcgccctccagcgc
gtcatctacacggagagccacgacgaggtggccaacggcaagcagcgcctgcccagcgag
gtgggcggctgggacgcggggggctaccacgccaagaagcgctccatcatcggcgcggcc
ctcaccatgacgagccccggcatcccgatgatcttccagggccaggagttcctggaggac
ggccacttccaggacgcggatccgctcgactggaagaagaaggagacctacgccggcatc
aaccaggcgtacacggacctcatcaagctgcgccgcaactggaacgacaacaccgccggc
ctgcgcggtgagaacgtcaatgtccaccacgtgaacaacaacgacaaggtcgtcgccttc
caccgctgggacaagggcggcgcgggggacgacaccatcgtcgtggtgaacatgggcggc
aagcacctgtccaactacgacctgggcctgccggccgacggcacctggaaggtccgcttc
aacagcgactggcagggttattccggtgacttcggcaacgcccagagcttcgacgtgggc
ggccggtggaacggcaaggacgggatgccggccagcggcacgctgaataacctggggccc
tatagcgtgctcatcctctccaaggacaagtga

DBGET integrated database retrieval system