KEGG   Myxococcus fulvus: LILAB_25525Help
Entry
LILAB_25525       CDS       T01558                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mfu  Myxococcus fulvus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mfu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mfu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6033124..6034017
Genome map
AA seq 297 aa AA seqDB search
MRHLLGIEGWRRDELESLLDRAKAHLPGGPDATHLLRGRVVANVFFEDSTRTRTSFHMAA
KGLGASVLNWTHTGSSVSKGETLLDTARNIEATGPVAIVMRHRSSGAPHLVAKHVKCAVI
NAGDGTHEHPSQALLDAFTLRQRWGSLEGRTVLIVGDVLHSRVARSNLHCLKALGARVVM
CGPPTLMPPGLEALGAEVTHNLDAALPQADAVMCLRIQLERQGQAFLPSTREYARLFGLN
AAREARMKADAVVMHPGPINRGVELAPAVADGPRSVILEQVSNGVAVRRAILEVCAA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagacacctgcttggaatcgaaggctggcgccgggacgagctggagtcactgctcgac
cgggcgaaggcacacctccccggcggtcccgatgccacccacctgctccgcggcagggtg
gtggccaacgtcttcttcgaggactccacccggacgcgcacgtcgttccacatggcggcc
aaggggctgggcgccagtgtgctcaactggacccacaccggctcctcggtgtccaagggt
gagacgctgctggacaccgcccgcaacatcgaggcaacggggccggtggccatcgtcatg
cgccaccgctcatccggggcgccgcacctggtggcgaagcacgtgaagtgcgccgtcatc
aacgcgggggacggcacgcacgagcacccctcccaggcgctgctggacgccttcacgctg
cgtcagcgctggggctcgctggaggggcgcacggtgctcatcgtgggcgacgtgctgcac
agccgcgtggcccgctccaacctgcactgcctcaaggcgctgggcgcccgggtggtgatg
tgcggcccgcccacgctgatgccgccggggctggaggcgctgggcgcggaggtgacgcac
aacctggacgcggcgctcccgcaggcggacgcggtgatgtgcctgcgcatccagttggag
cggcaggggcaggcgttcctgccctccacgcgtgaatatgcgcggctgttcggcctcaac
gcggcccgcgaggcgcggatgaaggcggacgcggtggtgatgcatccgggccccatcaac
cggggcgtggagctggcgccagcggtggcggacgggccccgcagcgtcatcctggagcag
gtgtccaacggcgtcgccgtgcggcgggccatcctggaggtgtgtgcggcatga

DBGET integrated database retrieval system