KEGG   Myxococcus fulvus: LILAB_27735Help
Entry
LILAB_27735       CDS       T01558                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mfu  Myxococcus fulvus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mfu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6696709..6698271
Genome map
AA seq 520 aa AA seqDB search
MLHADLAFDDLAAPLGFVEGGFSIGQSQVRLVQHRMLRSVLLEGADRIVAIVLERFADDP
EGLEHVVDATDGQIQTHLDDLEDYPLDFAALTIDRRRRAIRYTASPTISIPVYCLATAGR
ARFDWDYARLLGSGPHEIVWDYALAQIAGVSTYGPATVVSGLYRATSGATLVVTTAGVDA
ILPEPVRHDGPRELPPGVDAEALFRETVISILDARPLDPRRTAVELSGGMDSALTGLATA
HVTGDGAMSLGAQFDGAMGEAQRARRLLLCRAGSFADLSVPAGRYAPFSPRSLRRRRHQV
WPEDENYPEIFEAAFHMLRAAGIDTLVSGFGGDELYFAYRDEAGEDGVAAEPPPCPFLTA
RGMATALSARSTYPSAWLQQTCWQSAASQSQRVLRYGLWPVYPYLNVALARFVSRLPAAF
RRDRRILRRTLTRWLGNPVFETAYVKESFDPVARRGIAENRAWLQALVRHSPLSRHAEID
TAAILAALDSDIDRLDRARYNALFRFLKIACFFQSDRPLN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacgccgaccttgcgttcgacgatcttgcagccccccttggtttcgtcgagggg
ggcttttccatcggccaatcacaggtcaggctcgtgcagcaccggatgctgcgttccgtg
ctcctggagggcgcggatcggatcgtcgccattgtcctggagcgcttcgcagacgatccg
gaagggctcgagcatgtcgtcgatgccacggatggccagatccagacacacctcgacgac
cttgaagactacccgctcgatttcgccgcgttgaccatcgaccgcaggcgacgggcaatc
cgctacacggcgtcgccgacgatatcaatcccagtctattgcctcgcgacggcgggccgc
gctcgcttcgattgggactacgcccgcctgctcggaagcggcccccacgaaatcgtatgg
gattacgcgctcgcccagattgccggcgtctccacctacggcccggcgacggttgtgtcg
gggctctatcgcgccacgtcaggggccacgctggtggtcaccacggcgggagtggatgcc
attctgccggagcccgtgcgtcacgacggtccacgcgagttgcccccaggtgtcgatgcc
gaggcgttgttccgcgagacggtgatttcgatcctcgacgcgcgcccccttgacccgcgg
cgaaccgcggtggagctgagcggcggcatggactcggcgcttaccggcctcgccacggcg
cacgtgactggcgacggcgcgatgagcctgggcgcgcaattcgacggcgcgatgggggaa
gcgcaacgcgcgcgccgcctgctgttgtgccgagctggcagcttcgccgacctttccgta
ccggccgggcgctatgcccccttctccccgcggagcctccggcgacgccgccatcaggtg
tggcccgaagatgagaactacccggagatctttgaagctgcatttcacatgctgcgcgcc
gcggggattgacacgctcgtctcgggcttcggtggggacgagctctatttcgcctatcga
gacgaggccggggaggatggcgtcgcggccgagccgccgccgtgcccgttcctcacggcc
cgtggcatggcgaccgcgctcagcgcgcgcagcacgtatccgtcggcctggttgcagcag
acctgttggcaaagcgccgcgagccaatcgcagcgggtgctgcggtacggcctatggcca
gtctatccctatctgaacgtcgccctggcgcgctttgtctcacgcctgcccgcggccttc
cggcgcgaccgccgcatcctgcgacggacgctgacccggtggctgggcaatccagtgttc
gagacggcgtacgtcaaggagagctttgacccggtggcgcgacgcggcatcgccgaaaac
cgcgcctggctgcaagcgctcgtcagacactctccgctatcgcgccacgccgagatcgac
accgcggcgatcctcgcggcgctcgacagcgacatcgaccgcctcgaccgggcccgctac
aacgcgctgttccggttcctcaaaatcgcctgcttcttccagtccgaccgccctctcaac
tga

DBGET integrated database retrieval system