KEGG   Myxococcus fulvus: LILAB_28205Help
Entry
LILAB_28205       CDS       T01558                                 

Definition
6-phosphofructokinase I
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_28205
   01230 Biosynthesis of amino acids
    LILAB_28205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_28205
   00030 Pentose phosphate pathway
    LILAB_28205
   00051 Fructose and mannose metabolism
    LILAB_28205
   00052 Galactose metabolism
    LILAB_28205
  Energy metabolism
   00680 Methane metabolism
    LILAB_28205
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LILAB_28205
Protein phosphatases and associated proteins [BR:mfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LILAB_28205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6854317..6855402
Genome map
AA seq 361 aa AA seqDB search
MRLGVLTGGGDCPGLNALIRGLVKRGTHEFGHEFVGIENGYMGLVEPGLARPLTEDDTRG
ILPKGGTILGTSNKANPFAYATHEDGHWVERDVSDQVLRRCEELGLDGLIAVGGDGTLSI
AHRLVEKGLKVVGCPKTIDNDLSGTDQTFGFDTARLIVTEALDRLHSTAEAHDRVMVVEI
MGRHAGFLTLESGIAGGADVILIPEIPYRVDAVVEKIRRRSTRRRSFSIIAISEGAFPQG
GELAVLDAAEAIPGRGVVRLGGSGKVLADLLARHVEAEIRVTVLGHLQRGGSPSAADRVL
ATRYGCKVLDLVSAGQWDHMVALRAGEIIAVPLSESRKERRVDPAGELVRFTKSMGISFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagactcggagtcctgaccggtggcggagactgccccggcctcaacgccctcattcgc
ggcctcgtgaagcggggcacgcacgagttcggccatgagttcgtgggcatcgagaacggc
tacatggggctggtggagccagggctcgcacgcccgctcaccgaggacgacacgcgcggc
atcctccccaagggcggcaccatcctgggcacgtcgaacaaggcgaacccgttcgcctac
gcgacccatgaggacgggcactgggtggagcgcgacgtgtccgaccaggtcctgcgccgc
tgcgaggagctgggcctggacgggctcatcgccgtgggtggcgacgggacgctctccatc
gcccaccggctggtggaaaagggcctcaaggtggtcggctgtccgaagaccatcgacaac
gacttgtcggggacggatcagaccttcggcttcgacaccgcgcggctcatcgtcaccgag
gcgctcgaccggctgcactccaccgccgaggcgcatgaccgggtgatggtggtggagatc
atgggccgccacgccggcttcctcacgctggagagcggcatcgccgggggcgcggacgtc
atcctgattccagagattccgtaccgggtggacgccgtggtggagaagatccgccgccgc
tccacccgccgccgcagcttctccatcatcgccatctccgagggcgcgttcccccagggg
ggcgagctggccgtgctggacgcggcggaggccattccgggccggggcgtggtacggctc
ggcggctcgggcaaggtgctggcggacctgctggcccgtcacgtcgaggcggagatccgc
gtcacggtgctgggccacctgcagcgcggcggcagccccagcgcggcggaccgggtgctg
gccacccgctacggctgcaaggtgctggacctggtgagcgcgggccagtgggaccacatg
gtggccctgcgcgcgggtgagatcatcgcggtacccttgagcgagtcgcgcaaggagcgc
cgggtggatccggcgggtgagctggtgcgcttcaccaagagcatgggcatcagcttcggg
gactga

DBGET integrated database retrieval system