KEGG   Myxococcus fulvus: LILAB_28680Help
Entry
LILAB_28680       CDS       T01558                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mfu  Myxococcus fulvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LILAB_28680
Enzymes [BR:mfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LILAB_28680
Exosome [BR:mfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LILAB_28680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6990227..6991195)
Genome map
AA seq 322 aa AA seqDB search
MAYPIHRPRRLRRNAVLRDMVRETRLDPGDFIYPLFVVEGRDVRRPIVSMPGIFNLSLEH
VVAEARRARGLGVPAVLLFGIPNHKDAHGTQAYADDGIVQRAIREIKAAEPDLQVVVDIC
LCEFTDHGHCGVLEGGHVVNDATLPLLAKMAVSCAKAGADIIAPSDMMDGRVAAIRAALD
EAGFGELPIMAYSAKFASGYYGPFREAAQNTPSSGDRRGYQMDPGNVREALKEVALDVEE
GADLIMVKPALAYLDVIRAVRERWELPVVSYNVSGEYSMLKAAGQNGWIDYERVMLETLT
SMKRAGSDLIITYHALEAAKLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcccatccaccgaccccgccgcctgcgccgcaacgccgtcctgcgcgacatg
gtgcgtgagacgcgcctcgacccgggcgacttcatctaccccctcttcgtcgtggaaggc
cgggacgtgcgccgtcccatcgtctccatgccgggcatcttcaacctgtccctggagcac
gtcgtcgccgaggcccggcgggcccgcgggctgggcgtgcccgccgtgctcctgttcggc
atcccgaaccacaaggacgcgcacggcacccaggcctacgcagacgacggcatcgtccag
cgcgccatccgggagatcaaggcggccgagccggacctccaggtcgtcgtggacatctgc
ctctgcgagttcaccgaccatggccactgcggcgtgctggagggcggccacgtcgtcaat
gacgccacgctgccgctgctggcgaagatggccgtgagctgcgcgaaggcgggcgcggac
atcatcgccccgtcggacatgatggacggccgcgtggccgccatccgcgccgcgctggat
gaggcgggcttcggcgagctgcccatcatggcgtactcggccaagttcgcgtccggctac
tacgggcccttccgcgaggccgcgcagaacaccccgtcctccggtgaccgccggggctac
cagatggaccccggcaacgtccgggaggccctcaaggaggtggccctggacgtggaggag
ggcgcggacctcatcatggtgaagcccgcgctcgcctacctggacgtcatccgggccgtg
cgggagcggtgggagctgcccgtcgtctcctacaacgtctccggtgagtactcgatgctc
aaggcagccgggcagaatggttggattgactacgagcgggtgatgctggagacgcttacg
tccatgaagcgcgccggctccgacctcatcatcacctaccacgccctggaggcggcgaag
ctcctgtag

DBGET integrated database retrieval system