KEGG   Myxococcus fulvus: LILAB_29225Help
Entry
LILAB_29225       CDS       T01558                                 

Definition
alpha keto acid dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mfu  Myxococcus fulvus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_29225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_29225
   00020 Citrate cycle (TCA cycle)
    LILAB_29225
   00620 Pyruvate metabolism
    LILAB_29225
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LILAB_29225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7119420..7120685)
Genome map
AA seq 421 aa AA seqDB search
MAIFEFKLPDLGEGVMEGELVKWHVKAGDSVKEDQVLAEVMTDKATVTVPAPKAGRVVQT
HGKEGDMAKVHQLLVTLEVEGDAPAQAGGHGEASAPAAAPVAAAPATGGNGGGAPASSSK
VLATPVTRRMAREHGLDLSAIPGTGPQGRVTKADVVAALEGGEKNVVAAPAAQQARPAAP
PVSSGASDERIPLRGLRKKIAEKMVRSKFTAPHFAFVEEVDATDLVALRARLNAQLAAAG
ENIKLNYLPFIIKATVAALKKFPHLNANFDEARQELVVRGEFNIGMAAATPDGLTVAVVK
NADRLTLGELARETARLGAAARDRKLKMEELTGGTFTISSLGQSGGLFATPIINHPEVGI
LGVHRLKKRPAVVGDQVVVRDMMNLSLSCDHRVIDGSVAADFTYEIIKYLEKPDLLFLAM
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttcgaattcaagctccccgacctcggtgaaggcgtgatggagggtgagttg
gtgaagtggcacgtgaaggcgggggattccgtcaaggaagaccaggtgctcgccgaggtg
atgacggacaaggccaccgtcaccgtccccgcgcccaaggcgggccgtgtcgtgcagacg
cacggcaaggaaggggacatggcgaaggtgcaccagctcctcgtcacgctggaggtcgag
ggtgacgcgccggcgcaggccggtggccatggtgaggcgagcgcgccggcggcggcgccc
gtggccgccgcgcccgcgacgggtggcaatggcgggggggcgcctgcctcgtcgtccaag
gtgctggccacgccggtgacgcggcggatggcgcgcgagcacggcctggacctgtcggcg
attcccggcaccgggccgcagggccgcgtgacgaaggcggacgtggtggcggcgctggag
ggtggcgagaagaacgtggtggcggctccggccgcgcagcaggcgcgccccgcggcgccc
ccggtcagctcgggcgcttcggacgagcgcatcccgcttcggggcctgcgcaagaagatc
gcggagaagatggtgcggtcgaagttcaccgcgccgcacttcgccttcgtggaggaagtg
gacgccacggacctggtggccctgcgcgcgcggctgaacgcgcagctcgcggcggccggt
gaaaacatcaagctcaactacctgccgttcatcatcaaggcgacggtggcggcgctgaag
aagttcccgcacctgaacgcgaacttcgacgaggccaggcaggagctggtggtccgcggc
gagttcaacatcggcatggcggcggccacgccggacggcctcaccgtggcggtggtgaag
aacgcggaccggctgacgctgggcgagctggcgcgtgagacggcccgcctgggcgccgcc
gcgcgggaccgcaagctgaagatggaggagctgacgggcggcaccttcaccatcagctcg
ctggggcagagcggcggcctgttcgccacgcccatcatcaaccaccccgaggtgggcatc
ctcggcgtgcaccgcctgaagaagcgcccggcggtggtgggtgaccaggtcgtcgtgcgc
gacatgatgaacctgtcgctgtcgtgcgaccaccgcgtcatcgacggctcggtggcggcg
gacttcacgtacgagatcatcaagtacctggagaagccggacctgctgttcctggccatg
gcgtga

DBGET integrated database retrieval system