KEGG   Myxococcus fulvus: LILAB_29225Help
Entry
LILAB_29225       CDS       T01558                                 

Definition
(GenBank) alpha keto acid dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00010  Glycolysis / Gluconeogenesis
mfu00020  Citrate cycle (TCA cycle)
mfu00620  Pyruvate metabolism
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
Module
mfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LILAB_29225
   00020 Citrate cycle (TCA cycle)
    LILAB_29225
   00620 Pyruvate metabolism
    LILAB_29225
Enzymes [BR:mfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LILAB_29225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H DUF2118 NQRA
Motif
Other DBs
NCBI-ProteinID: AEI67726
UniProt: F8CLL7
Position
complement(7119420..7120685)
Genome map
AA seq 421 aa AA seqDB search
MAIFEFKLPDLGEGVMEGELVKWHVKAGDSVKEDQVLAEVMTDKATVTVPAPKAGRVVQT
HGKEGDMAKVHQLLVTLEVEGDAPAQAGGHGEASAPAAAPVAAAPATGGNGGGAPASSSK
VLATPVTRRMAREHGLDLSAIPGTGPQGRVTKADVVAALEGGEKNVVAAPAAQQARPAAP
PVSSGASDERIPLRGLRKKIAEKMVRSKFTAPHFAFVEEVDATDLVALRARLNAQLAAAG
ENIKLNYLPFIIKATVAALKKFPHLNANFDEARQELVVRGEFNIGMAAATPDGLTVAVVK
NADRLTLGELARETARLGAAARDRKLKMEELTGGTFTISSLGQSGGLFATPIINHPEVGI
LGVHRLKKRPAVVGDQVVVRDMMNLSLSCDHRVIDGSVAADFTYEIIKYLEKPDLLFLAM
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttcgaattcaagctccccgacctcggtgaaggcgtgatggagggtgagttg
gtgaagtggcacgtgaaggcgggggattccgtcaaggaagaccaggtgctcgccgaggtg
atgacggacaaggccaccgtcaccgtccccgcgcccaaggcgggccgtgtcgtgcagacg
cacggcaaggaaggggacatggcgaaggtgcaccagctcctcgtcacgctggaggtcgag
ggtgacgcgccggcgcaggccggtggccatggtgaggcgagcgcgccggcggcggcgccc
gtggccgccgcgcccgcgacgggtggcaatggcgggggggcgcctgcctcgtcgtccaag
gtgctggccacgccggtgacgcggcggatggcgcgcgagcacggcctggacctgtcggcg
attcccggcaccgggccgcagggccgcgtgacgaaggcggacgtggtggcggcgctggag
ggtggcgagaagaacgtggtggcggctccggccgcgcagcaggcgcgccccgcggcgccc
ccggtcagctcgggcgcttcggacgagcgcatcccgcttcggggcctgcgcaagaagatc
gcggagaagatggtgcggtcgaagttcaccgcgccgcacttcgccttcgtggaggaagtg
gacgccacggacctggtggccctgcgcgcgcggctgaacgcgcagctcgcggcggccggt
gaaaacatcaagctcaactacctgccgttcatcatcaaggcgacggtggcggcgctgaag
aagttcccgcacctgaacgcgaacttcgacgaggccaggcaggagctggtggtccgcggc
gagttcaacatcggcatggcggcggccacgccggacggcctcaccgtggcggtggtgaag
aacgcggaccggctgacgctgggcgagctggcgcgtgagacggcccgcctgggcgccgcc
gcgcgggaccgcaagctgaagatggaggagctgacgggcggcaccttcaccatcagctcg
ctggggcagagcggcggcctgttcgccacgcccatcatcaaccaccccgaggtgggcatc
ctcggcgtgcaccgcctgaagaagcgcccggcggtggtgggtgaccaggtcgtcgtgcgc
gacatgatgaacctgtcgctgtcgtgcgaccaccgcgtcatcgacggctcggtggcggcg
gacttcacgtacgagatcatcaagtacctggagaagccggacctgctgttcctggccatg
gcgtga

DBGET integrated database retrieval system