KEGG   Myxococcus fulvus: LILAB_29895Help
Entry
LILAB_29895       CDS       T01558                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mfu  Myxococcus fulvus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mfu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7310225..7311457)
Genome map
AA seq 410 aa AA seqDB search
MIRARVVTAEHPEDLVLAFRRMGLAPSSLAALRESLPHTRLLLTGLGTQALHFLQRLQAL
SDAPAALPAWLAGEAGGRPGTGMLSGHAEQFRLLVDLARGGRDELPALSKAVAAALASGT
APPALVLGDKRFEWGARTYVMGVVNVTPDSFSDGGRFFDPEAAIAHGLALAEAGADLLDV
GGESTRPGALPVSAEAEVARVVPVIEGLRARTSVPLSVDTTKAAVAREALRAGAHLINDV
TGFGADADLPRVVAEAGAACCLMHIQGTPATMQQAPRYDDVIEDVLGFLEAAVARAEAAG
VPRERILLDPGIGFGKTFEHNLFLLRRLNELRVLGLPLLVGTSRKGFLGRLAGGKPASER
LAATLGSVASMAALGGADVVRVHDVAEARDALAVADAIRRSEDGGALYAR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgcccgcgtcgtcaccgccgagcaccccgaagacctggtcctcgccttccgg
cggatggggctggcccccagctcgctggcggcgctccgggagtcgctcccccacacgcgg
ctgctcctcacggggctggggacgcaggcgctgcacttcctccagaggttgcaggccctg
tccgacgctccggcggcgttgcccgcctggctcgcgggggaggccggggggcggcctgga
acgggcatgctgtcggggcacgccgaacagttcaggctgttggtggacctggctcgcgga
ggccgcgacgagctgccggccttgtccaaggccgtggctgccgcgctggcctcgggcacc
gcgccaccggcgctggtgctgggggacaagcgcttcgagtggggcgcgcgcacgtacgtc
atgggcgtggtgaacgtgacgccggacagcttctcggacggtgggcgcttcttcgacccg
gaggccgccatcgcccatgggctcgccctggcggaagcgggggccgacctgctcgacgtg
ggcggtgagtccacccggcctggcgcgttgcccgtcagcgccgaggccgaggtggcccgc
gtcgtccccgtcatcgagggcctgcgcgcgcggacgtccgtgccgctctcggtggacacc
accaaggccgcggtggcgcgtgaggcgctgcgggccggcgcgcacctcatcaacgacgtc
accggcttcggcgccgacgccgacctgccccgcgtggtggccgaggccggcgccgcctgc
tgcctgatgcacatccagggcaccccggccaccatgcagcaggcgccgcgctatgacgac
gtcatcgaggacgtgctgggcttcctggaggccgccgtcgcgcgcgccgaggcggcgggc
gttccccgggagcgcatcctcctggacccggggatcggcttcggcaagacgttcgagcac
aacctcttcctgctgcgccgcctcaacgagctgcgcgtcctggggctgccgctgctcgtc
gggaccagccgcaagggcttcctcggccggctggcggggggcaagccagcctccgagcgg
ctggcggcgacgctgggctcggtggcctccatggccgcgctgggtggggccgacgtggtc
cgggtccatgacgtggccgaggcccgggacgcgctggccgtcgcggacgccatccggcgg
agcgaggacggcggggcgctctacgcccggtaa

DBGET integrated database retrieval system