KEGG   Myxococcus fulvus: LILAB_29895Help
Entry
LILAB_29895       CDS       T01558                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mfu  Myxococcus fulvus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LILAB_29895
Enzymes [BR:mfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LILAB_29895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7310225..7311457)
Genome map
AA seq 410 aa AA seqDB search
MIRARVVTAEHPEDLVLAFRRMGLAPSSLAALRESLPHTRLLLTGLGTQALHFLQRLQAL
SDAPAALPAWLAGEAGGRPGTGMLSGHAEQFRLLVDLARGGRDELPALSKAVAAALASGT
APPALVLGDKRFEWGARTYVMGVVNVTPDSFSDGGRFFDPEAAIAHGLALAEAGADLLDV
GGESTRPGALPVSAEAEVARVVPVIEGLRARTSVPLSVDTTKAAVAREALRAGAHLINDV
TGFGADADLPRVVAEAGAACCLMHIQGTPATMQQAPRYDDVIEDVLGFLEAAVARAEAAG
VPRERILLDPGIGFGKTFEHNLFLLRRLNELRVLGLPLLVGTSRKGFLGRLAGGKPASER
LAATLGSVASMAALGGADVVRVHDVAEARDALAVADAIRRSEDGGALYAR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgcccgcgtcgtcaccgccgagcaccccgaagacctggtcctcgccttccgg
cggatggggctggcccccagctcgctggcggcgctccgggagtcgctcccccacacgcgg
ctgctcctcacggggctggggacgcaggcgctgcacttcctccagaggttgcaggccctg
tccgacgctccggcggcgttgcccgcctggctcgcgggggaggccggggggcggcctgga
acgggcatgctgtcggggcacgccgaacagttcaggctgttggtggacctggctcgcgga
ggccgcgacgagctgccggccttgtccaaggccgtggctgccgcgctggcctcgggcacc
gcgccaccggcgctggtgctgggggacaagcgcttcgagtggggcgcgcgcacgtacgtc
atgggcgtggtgaacgtgacgccggacagcttctcggacggtgggcgcttcttcgacccg
gaggccgccatcgcccatgggctcgccctggcggaagcgggggccgacctgctcgacgtg
ggcggtgagtccacccggcctggcgcgttgcccgtcagcgccgaggccgaggtggcccgc
gtcgtccccgtcatcgagggcctgcgcgcgcggacgtccgtgccgctctcggtggacacc
accaaggccgcggtggcgcgtgaggcgctgcgggccggcgcgcacctcatcaacgacgtc
accggcttcggcgccgacgccgacctgccccgcgtggtggccgaggccggcgccgcctgc
tgcctgatgcacatccagggcaccccggccaccatgcagcaggcgccgcgctatgacgac
gtcatcgaggacgtgctgggcttcctggaggccgccgtcgcgcgcgccgaggcggcgggc
gttccccgggagcgcatcctcctggacccggggatcggcttcggcaagacgttcgagcac
aacctcttcctgctgcgccgcctcaacgagctgcgcgtcctggggctgccgctgctcgtc
gggaccagccgcaagggcttcctcggccggctggcggggggcaagccagcctccgagcgg
ctggcggcgacgctgggctcggtggcctccatggccgcgctgggtggggccgacgtggtc
cgggtccatgacgtggccgaggcccgggacgcgctggccgtcgcggacgccatccggcgg
agcgaggacggcggggcgctctacgcccggtaa

DBGET integrated database retrieval system