KEGG   Myxococcus fulvus: LILAB_30290Help
Entry
LILAB_30290       CDS       T01558                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mfu  Myxococcus fulvus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LILAB_30290
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     LILAB_30290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7422927..7423964
Genome map
AA seq 345 aa AA seqDB search
MATHFDPSAAAQPDSGVFGLPHSPEEAHVVLIPVPFEATTSYGGGTSEGPAAVLEASRQV
DLFDVETGRPYERGIAMLPEPQELRDWNTRAKERAQVVIEAGGIHSGEATLLQAAQDVNV
LCDQMNEHVYRTTKHWLDQGKRVAAVGGDHSISYGIIRAHAEKYPGMGVLHLDAHADLRV
AYEGFTWSHASIMYNVAERIPGVKTLVQVGLRDMSAEEHQYIADSNGRVHGFFDAALQHR
RFDGVPWNKQVDEMVSLLPQQVYLSFDIDGLDPVLCPHTGTPVPGGLSFPEAVALISGVV
RSGRTIVGFDLTEVAPDPEGGEWDGNVGARLLYKMIGWMLKSQRA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctacccacttcgaccccagcgccgccgcccagccggactccggcgtgttcggcctc
ccccactccccggaagaggcgcacgtcgtcctcatccccgtccccttcgaggccaccacc
agctacggcggcggcacgtccgagggcccggccgccgtcctggaggccagccggcaggtc
gacctcttcgacgtggagacgggccgcccctatgagcgcggcatcgccatgctccccgag
ccccaggagctgcgcgactggaacacccgcgccaaggagcgcgcccaggtcgtcatcgag
gccggcggcatccactcgggcgaggccacgctgctgcaggccgcgcaggacgtgaatgtc
ctctgcgaccagatgaacgagcacgtctaccgcaccaccaagcactggctggaccagggc
aagcgcgtggccgcggtgggcggggaccactccatctcctacggcatcatccgcgcgcac
gcggagaagtaccccggcatgggcgtgctgcacctggacgcgcacgccgacctgcgcgtg
gcctacgagggcttcacctggtcccacgcgtccatcatgtacaacgtcgcggagcgcatc
cccggcgtgaagacgctggtccaggtgggcctgcgcgacatgagcgcggaggagcaccag
tacatcgccgactccaacggccgcgtccacggcttcttcgacgccgcgctccagcacagg
cgcttcgacggcgtgccctggaacaagcaggtcgatgagatggtctccctgctgccgcag
caggtctacctgtccttcgacatcgacgggctggaccccgtgctctgcccgcacaccggc
accccggtgccgggcggcctgtccttcccggaggccgtcgcgctcatctccggcgtggtc
cgctccggacgcaccatcgtgggcttcgacctcaccgaggtggcccccgacccggaaggc
ggcgagtgggacggcaacgtcggcgcccgcctgctctacaagatgattggctggatgctg
aagtcgcagcgcgcttga

DBGET integrated database retrieval system