KEGG   Myxococcus fulvus: LILAB_34685Help
Entry
LILAB_34685       CDS       T01558                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00071  Fatty acid degradation
mfu00280  Valine, leucine and isoleucine degradation
mfu00281  Geraniol degradation
mfu00310  Lysine degradation
mfu00362  Benzoate degradation
mfu00380  Tryptophan metabolism
mfu00410  beta-Alanine metabolism
mfu00640  Propanoate metabolism
mfu00650  Butanoate metabolism
mfu00903  Limonene and pinene degradation
mfu00930  Caprolactam degradation
mfu01040  Biosynthesis of unsaturated fatty acids
mfu01100  Metabolic pathways
mfu01110  Biosynthesis of secondary metabolites
mfu01120  Microbial metabolism in diverse environments
mfu01130  Biosynthesis of antibiotics
mfu01200  Carbon metabolism
mfu01212  Fatty acid metabolism
Module
mfu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LILAB_34685 (fadJ)
   00650 Butanoate metabolism
    LILAB_34685 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_34685 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    LILAB_34685 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_34685 (fadJ)
   00310 Lysine degradation
    LILAB_34685 (fadJ)
   00380 Tryptophan metabolism
    LILAB_34685 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LILAB_34685 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LILAB_34685 (fadJ)
   00281 Geraniol degradation
    LILAB_34685 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LILAB_34685 (fadJ)
   00930 Caprolactam degradation
    LILAB_34685 (fadJ)
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LILAB_34685 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LILAB_34685 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LILAB_34685 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEI68818
UniProt: F8CJ36
Position
complement(8536213..8538453)
Genome map
AA seq 746 aa AA seqDB search
MATKAEELEVKQGFSYQVEDGVAVITFDLPDSPVNTLSPETGEAFLRVMSRAEREPEVKA
VVFTSGKKDSFVAGAKIDFLHTIKTAEEATAISRNGQEGFDKLDAFPKPVVAAIHGACLG
GGLEWALACDYRVATDSPKTSLGLPEVQLGLIPGAGGTQRLPALIGVQAALDLILTGKSL
KPGKAKKLGVVDEVVPAPILRAIAVRRAKELAEGKLKVERRHGQGFKGVAAGGKSKGLAG
FIQGLANKELWAEVALEDNPLGRKVLFDQARKQLLKKTRGKFPAPEKALQVVRVGLESGH
KAGQEAEAKAFGELVVSDVSKRLVEIFFATTALKKENGTASPDAKPREVKKVAVLGGGLM
GGGIAYVASSLQGVPVRVKDKDDAGVGRAMKQVQSILDERVKRRSLTRREATAKSALVTA
GTDYAGFKSADLVIEAVFEDLKLKHRIIAEVEAVTGDQTIFASNTSSIPITELAKGSRRP
AQVIGMHYFSPVHKMPLLEVITHAGTADWVTATCVEVGRKQGKTVIVVNDGPGFYTSRIL
APYMNEAAYLLAEGADIAELDRALVEFGFPVGPMTLLDEVGIDVAQKVGPIMEAAFGKRM
AAPKALEKVVADGRLGRKTEKGFYLYEGGKKQEVDPSIYALLPHGTERRSFDRAEMAERV
VLQMVNEAIRCLGEGILRSARDGDVGAIFGLGFPPFLGGPFHYVDSRGPADVLRKLEHFH
DKLGERFVPAPHLVEMVKAGKTFYPR
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaggcggaagagctcgaggtgaagcagggcttctcgtaccaggtggaggac
ggcgtcgccgtcatcaccttcgacctgccggactccccggtgaacacgctgtcgccggag
acgggcgaggccttcctgcgcgtcatgtcgcgcgcggagcgggagcccgaggtgaaggcc
gtggtcttcacgtccggcaagaaggactcgttcgtcgccggggcgaagatcgacttcctg
cataccatcaagacggcggaggaggccacggccatcagccgcaacggccaggagggcttc
gacaagctggacgccttccccaagcccgtcgtcgcggccatccacggcgcctgtctgggc
ggcggtctggagtgggcgctggcgtgtgactaccgcgtcgccaccgacagcccgaagacg
tcgctgggcctgccggaggtgcagctcggcctgattccgggcgcgggcggcacgcagcga
ctgccggcgctgattggcgtgcaggcggcgctggacctcatcctcaccggcaagagcctc
aagcctgggaaggcgaagaagctgggcgtggtggacgaggtggtgccggcgcccatcctc
cgcgccatcgccgtgcggcgcgcgaaggagctggccgaagggaagctgaaggtggagcgc
cgtcacggccagggcttcaagggcgtggccgccggcggcaagagcaagggcctggcgggc
ttcatccagggcctggcgaacaaggagctgtgggcggaggtggcgctggaggacaacccg
ctgggccgcaaggtcctcttcgaccaggcgcgcaagcagctcctgaagaagacgcgcggc
aagttccccgcgccggagaaggcgctccaggtggtgcgcgtgggcctggagtccgggcac
aaggcgggccaggaggcggaggcgaaggcctttggcgagctggtggtgtcggacgtctcc
aagcggctggtcgaaatcttcttcgccaccacggcgctgaagaaggagaacggcacggcc
agccccgacgcgaagccccgcgaggtgaagaaggtggcggtgctgggcggcgggctgatg
ggcggcggcatcgcctacgtggccagctcgctccagggcgtgccggtgcgcgtgaaggac
aaggatgacgcgggggtgggccgcgccatgaagcaggtgcagtccatcctggatgagcgc
gtgaagcgccgctcactcacccgccgcgaggccaccgcgaagtccgccctggtgacggcg
ggcacggactacgccggcttcaagtccgcggacctggtcatcgaggcggtgttcgaggac
ctgaagctcaagcaccgcatcatcgcggaggtggaggccgtcaccggcgaccagaccatc
ttcgcgtccaacacctccagcatcccgattacggagctggccaagggcagccgccggccg
gcgcaagtcattggcatgcattacttcagcccggtccacaagatgccgctcttggaggtc
atcacccacgcgggcaccgcggactgggtgacggccacctgcgtggaggtggggcgaaag
cagggcaagacggtcatcgtcgtcaacgacgggccgggcttctacacctcgcgcatcctc
gcgccgtacatgaacgaggcggcgtacctgctggcggaaggcgcggacatcgcggagctg
gacagggcgctggtcgagtttggcttcccggtgggcccgatgaccctcctggacgaggtg
ggcatcgacgtggcgcagaaggtgggccccatcatggaggccgccttcggcaagcgcatg
gcggcgcccaaggccctggagaaggtcgtggccgacggccgcctgggccgcaagacggag
aagggcttctacctgtacgagggcggcaagaagcaggaggtggacccctccatctacgcc
ctgctgccgcacggcaccgagcgccgctccttcgaccgcgcggagatggccgagcgcgtg
gtgctgcagatggtcaacgaggccatccgctgcctgggcgagggcatcctccgcagcgcg
cgggacggcgacgtgggcgccatcttcggcctcggcttcccgcccttcctcgggggcccc
ttccactacgtggacagccgcggccccgccgacgtgctgcgcaagctggagcacttccac
gacaagctcggggagcgctttgtccccgcgccgcatctggtggagatggtgaaggcgggc
aagacgttctacccgcgctga

DBGET integrated database retrieval system