KEGG   Myxococcus fulvus: LILAB_34685Help
Entry
LILAB_34685       CDS       T01558                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mfu  Myxococcus fulvus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_34685 (fadJ)
   01212 Fatty acid metabolism
    LILAB_34685 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LILAB_34685 (fadJ)
   00650 Butanoate metabolism
    LILAB_34685 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    LILAB_34685 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    LILAB_34685 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LILAB_34685 (fadJ)
   00310 Lysine degradation
    LILAB_34685 (fadJ)
   00380 Tryptophan metabolism
    LILAB_34685 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LILAB_34685 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LILAB_34685 (fadJ)
   00281 Geraniol degradation
    LILAB_34685 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    LILAB_34685 (fadJ)
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LILAB_34685 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LILAB_34685 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LILAB_34685 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8536213..8538453)
Genome map
AA seq 746 aa AA seqDB search
MATKAEELEVKQGFSYQVEDGVAVITFDLPDSPVNTLSPETGEAFLRVMSRAEREPEVKA
VVFTSGKKDSFVAGAKIDFLHTIKTAEEATAISRNGQEGFDKLDAFPKPVVAAIHGACLG
GGLEWALACDYRVATDSPKTSLGLPEVQLGLIPGAGGTQRLPALIGVQAALDLILTGKSL
KPGKAKKLGVVDEVVPAPILRAIAVRRAKELAEGKLKVERRHGQGFKGVAAGGKSKGLAG
FIQGLANKELWAEVALEDNPLGRKVLFDQARKQLLKKTRGKFPAPEKALQVVRVGLESGH
KAGQEAEAKAFGELVVSDVSKRLVEIFFATTALKKENGTASPDAKPREVKKVAVLGGGLM
GGGIAYVASSLQGVPVRVKDKDDAGVGRAMKQVQSILDERVKRRSLTRREATAKSALVTA
GTDYAGFKSADLVIEAVFEDLKLKHRIIAEVEAVTGDQTIFASNTSSIPITELAKGSRRP
AQVIGMHYFSPVHKMPLLEVITHAGTADWVTATCVEVGRKQGKTVIVVNDGPGFYTSRIL
APYMNEAAYLLAEGADIAELDRALVEFGFPVGPMTLLDEVGIDVAQKVGPIMEAAFGKRM
AAPKALEKVVADGRLGRKTEKGFYLYEGGKKQEVDPSIYALLPHGTERRSFDRAEMAERV
VLQMVNEAIRCLGEGILRSARDGDVGAIFGLGFPPFLGGPFHYVDSRGPADVLRKLEHFH
DKLGERFVPAPHLVEMVKAGKTFYPR
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaggcggaagagctcgaggtgaagcagggcttctcgtaccaggtggaggac
ggcgtcgccgtcatcaccttcgacctgccggactccccggtgaacacgctgtcgccggag
acgggcgaggccttcctgcgcgtcatgtcgcgcgcggagcgggagcccgaggtgaaggcc
gtggtcttcacgtccggcaagaaggactcgttcgtcgccggggcgaagatcgacttcctg
cataccatcaagacggcggaggaggccacggccatcagccgcaacggccaggagggcttc
gacaagctggacgccttccccaagcccgtcgtcgcggccatccacggcgcctgtctgggc
ggcggtctggagtgggcgctggcgtgtgactaccgcgtcgccaccgacagcccgaagacg
tcgctgggcctgccggaggtgcagctcggcctgattccgggcgcgggcggcacgcagcga
ctgccggcgctgattggcgtgcaggcggcgctggacctcatcctcaccggcaagagcctc
aagcctgggaaggcgaagaagctgggcgtggtggacgaggtggtgccggcgcccatcctc
cgcgccatcgccgtgcggcgcgcgaaggagctggccgaagggaagctgaaggtggagcgc
cgtcacggccagggcttcaagggcgtggccgccggcggcaagagcaagggcctggcgggc
ttcatccagggcctggcgaacaaggagctgtgggcggaggtggcgctggaggacaacccg
ctgggccgcaaggtcctcttcgaccaggcgcgcaagcagctcctgaagaagacgcgcggc
aagttccccgcgccggagaaggcgctccaggtggtgcgcgtgggcctggagtccgggcac
aaggcgggccaggaggcggaggcgaaggcctttggcgagctggtggtgtcggacgtctcc
aagcggctggtcgaaatcttcttcgccaccacggcgctgaagaaggagaacggcacggcc
agccccgacgcgaagccccgcgaggtgaagaaggtggcggtgctgggcggcgggctgatg
ggcggcggcatcgcctacgtggccagctcgctccagggcgtgccggtgcgcgtgaaggac
aaggatgacgcgggggtgggccgcgccatgaagcaggtgcagtccatcctggatgagcgc
gtgaagcgccgctcactcacccgccgcgaggccaccgcgaagtccgccctggtgacggcg
ggcacggactacgccggcttcaagtccgcggacctggtcatcgaggcggtgttcgaggac
ctgaagctcaagcaccgcatcatcgcggaggtggaggccgtcaccggcgaccagaccatc
ttcgcgtccaacacctccagcatcccgattacggagctggccaagggcagccgccggccg
gcgcaagtcattggcatgcattacttcagcccggtccacaagatgccgctcttggaggtc
atcacccacgcgggcaccgcggactgggtgacggccacctgcgtggaggtggggcgaaag
cagggcaagacggtcatcgtcgtcaacgacgggccgggcttctacacctcgcgcatcctc
gcgccgtacatgaacgaggcggcgtacctgctggcggaaggcgcggacatcgcggagctg
gacagggcgctggtcgagtttggcttcccggtgggcccgatgaccctcctggacgaggtg
ggcatcgacgtggcgcagaaggtgggccccatcatggaggccgccttcggcaagcgcatg
gcggcgcccaaggccctggagaaggtcgtggccgacggccgcctgggccgcaagacggag
aagggcttctacctgtacgagggcggcaagaagcaggaggtggacccctccatctacgcc
ctgctgccgcacggcaccgagcgccgctccttcgaccgcgcggagatggccgagcgcgtg
gtgctgcagatggtcaacgaggccatccgctgcctgggcgagggcatcctccgcagcgcg
cgggacggcgacgtgggcgccatcttcggcctcggcttcccgcccttcctcgggggcccc
ttccactacgtggacagccgcggccccgccgacgtgctgcgcaagctggagcacttccac
gacaagctcggggagcgctttgtccccgcgccgcatctggtggagatggtgaaggcgggc
aagacgttctacccgcgctga

DBGET integrated database retrieval system