KEGG   Myxococcus fulvus: LILAB_34735Help
Entry
LILAB_34735       CDS       T01558                                 

Definition
(RefSeq) alcohol dehydrogenase groes domain-containing protein
Organism
mfu  Myxococcus fulvus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8555463..8556605)
Genome map
AA seq 380 aa AA seqDB search
MKALVYEGPRKVSVKEVPDAKIERPTDAVVRIRSTNICGSDLHMYEGRTDMEPGRVLGHE
NLGEVVEVGSAVDKLKVGDWVAIPFNVSCGHCENCEHGLTAFCLNANPSGTAGAAYGFAD
MGPYNGGQAEYLRVPWADFNCLRLPEDAEEKQLDYVMLADIFPTGYHVTELAGLLPGESV
VIFGGGPVGQMAALSATIKSASKVMVVDWHPDRLALCEKIGAIPIDYSKVDPVERVKELT
NGKGADRGCECVGYQAHDPQGREHPNLTMNNLVKAVKFTGGIGVVGVFIPNDPGGPDTLA
KQGEIVFDWGMLWFKGQRVATGQCNVKAYNRQLRELIHLDKVKPSWIVSHTLPLDKAPDG
YLNFDKRDSGWTKVVLQPAA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcgtctacgagggaccgcgcaaggtcagtgtgaaagaggtgccggacgcg
aagattgagcggcccaccgatgcggtggtgcgcattcgcagtaccaacatctgcggctcc
gacctgcacatgtacgaaggccgcaccgacatggagccgggccgggtgctcgggcacgag
aacctcggagaggtggtcgaggtcggctcggcggtggacaagctgaaggtgggcgactgg
gtggccattccgttcaacgtcagttgtggccactgcgagaactgcgagcacggcctgacc
gccttctgcctcaacgcgaacccgtcggggacggccggcgccgcatatggcttcgccgac
atggggccctacaacggcgggcaggccgagtacctgcgcgtgccctgggccgacttcaac
tgcctgcggctgccggaggacgccgaggagaagcagctcgactacgtgatgctcgccgac
atcttccccaccggctaccacgtcaccgagctcgccgggctcctgccgggcgaatccgtc
gtcatcttcggtggagggcccgtgggacagatggccgcgctctccgccaccatcaagagc
gcgagcaaggtgatggtcgtcgactggcatccggaccggctcgctctctgcgagaagatt
ggcgccatccccatcgactactcgaaggtggaccccgtcgagcgggtgaaggaactcacc
aacggcaagggtgccgaccgcggctgcgagtgcgtgggctaccaggcgcacgacccacag
gggagggagcaccccaacctgacgatgaacaatctggtgaaggcggtgaagttcaccggc
ggcatcggcgtggtgggcgtcttcatccccaatgaccccggcggcccggacaccctggcc
aagcagggggaaatcgtcttcgactggggcatgctctggttcaaggggcagcgcgtggcg
accggccagtgcaacgtgaaggcctacaaccgccaactgcgcgagctcatccacctggac
aaggtgaagccctcgtggatcgtctcgcacacgctcccgcttgacaaggcgccggacggc
tacctgaacttcgacaaacgcgacagcggctggaccaaggtcgtcctgcagccggccgcc
tga

DBGET integrated database retrieval system