KEGG   Myxococcus fulvus: LILAB_34735Help
Entry
LILAB_34735       CDS       T01558                                 

Definition
alcohol dehydrogenase groes domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mfu  Myxococcus fulvus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LILAB_34735
  Energy metabolism
   00680 Methane metabolism
    LILAB_34735
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LILAB_34735
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     LILAB_34735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8555463..8556605)
Genome map
AA seq 380 aa AA seqDB search
MKALVYEGPRKVSVKEVPDAKIERPTDAVVRIRSTNICGSDLHMYEGRTDMEPGRVLGHE
NLGEVVEVGSAVDKLKVGDWVAIPFNVSCGHCENCEHGLTAFCLNANPSGTAGAAYGFAD
MGPYNGGQAEYLRVPWADFNCLRLPEDAEEKQLDYVMLADIFPTGYHVTELAGLLPGESV
VIFGGGPVGQMAALSATIKSASKVMVVDWHPDRLALCEKIGAIPIDYSKVDPVERVKELT
NGKGADRGCECVGYQAHDPQGREHPNLTMNNLVKAVKFTGGIGVVGVFIPNDPGGPDTLA
KQGEIVFDWGMLWFKGQRVATGQCNVKAYNRQLRELIHLDKVKPSWIVSHTLPLDKAPDG
YLNFDKRDSGWTKVVLQPAA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcgtctacgagggaccgcgcaaggtcagtgtgaaagaggtgccggacgcg
aagattgagcggcccaccgatgcggtggtgcgcattcgcagtaccaacatctgcggctcc
gacctgcacatgtacgaaggccgcaccgacatggagccgggccgggtgctcgggcacgag
aacctcggagaggtggtcgaggtcggctcggcggtggacaagctgaaggtgggcgactgg
gtggccattccgttcaacgtcagttgtggccactgcgagaactgcgagcacggcctgacc
gccttctgcctcaacgcgaacccgtcggggacggccggcgccgcatatggcttcgccgac
atggggccctacaacggcgggcaggccgagtacctgcgcgtgccctgggccgacttcaac
tgcctgcggctgccggaggacgccgaggagaagcagctcgactacgtgatgctcgccgac
atcttccccaccggctaccacgtcaccgagctcgccgggctcctgccgggcgaatccgtc
gtcatcttcggtggagggcccgtgggacagatggccgcgctctccgccaccatcaagagc
gcgagcaaggtgatggtcgtcgactggcatccggaccggctcgctctctgcgagaagatt
ggcgccatccccatcgactactcgaaggtggaccccgtcgagcgggtgaaggaactcacc
aacggcaagggtgccgaccgcggctgcgagtgcgtgggctaccaggcgcacgacccacag
gggagggagcaccccaacctgacgatgaacaatctggtgaaggcggtgaagttcaccggc
ggcatcggcgtggtgggcgtcttcatccccaatgaccccggcggcccggacaccctggcc
aagcagggggaaatcgtcttcgactggggcatgctctggttcaaggggcagcgcgtggcg
accggccagtgcaacgtgaaggcctacaaccgccaactgcgcgagctcatccacctggac
aaggtgaagccctcgtggatcgtctcgcacacgctcccgcttgacaaggcgccggacggc
tacctgaacttcgacaaacgcgacagcggctggaccaaggtcgtcctgcagccggccgcc
tga

DBGET integrated database retrieval system