KEGG   Myxococcus fulvus: LILAB_34735Help
Entry
LILAB_34735       CDS       T01558                                 

Definition
(GenBank) alcohol dehydrogenase groes domain protein
Organism
mfu  Myxococcus fulvus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc AlaDh_PNT_C Glu_dehyd_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEI68828
UniProt: F8CJ46
Position
complement(8555463..8556605)
Genome map
AA seq 380 aa AA seqDB search
MKALVYEGPRKVSVKEVPDAKIERPTDAVVRIRSTNICGSDLHMYEGRTDMEPGRVLGHE
NLGEVVEVGSAVDKLKVGDWVAIPFNVSCGHCENCEHGLTAFCLNANPSGTAGAAYGFAD
MGPYNGGQAEYLRVPWADFNCLRLPEDAEEKQLDYVMLADIFPTGYHVTELAGLLPGESV
VIFGGGPVGQMAALSATIKSASKVMVVDWHPDRLALCEKIGAIPIDYSKVDPVERVKELT
NGKGADRGCECVGYQAHDPQGREHPNLTMNNLVKAVKFTGGIGVVGVFIPNDPGGPDTLA
KQGEIVFDWGMLWFKGQRVATGQCNVKAYNRQLRELIHLDKVKPSWIVSHTLPLDKAPDG
YLNFDKRDSGWTKVVLQPAA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcgtctacgagggaccgcgcaaggtcagtgtgaaagaggtgccggacgcg
aagattgagcggcccaccgatgcggtggtgcgcattcgcagtaccaacatctgcggctcc
gacctgcacatgtacgaaggccgcaccgacatggagccgggccgggtgctcgggcacgag
aacctcggagaggtggtcgaggtcggctcggcggtggacaagctgaaggtgggcgactgg
gtggccattccgttcaacgtcagttgtggccactgcgagaactgcgagcacggcctgacc
gccttctgcctcaacgcgaacccgtcggggacggccggcgccgcatatggcttcgccgac
atggggccctacaacggcgggcaggccgagtacctgcgcgtgccctgggccgacttcaac
tgcctgcggctgccggaggacgccgaggagaagcagctcgactacgtgatgctcgccgac
atcttccccaccggctaccacgtcaccgagctcgccgggctcctgccgggcgaatccgtc
gtcatcttcggtggagggcccgtgggacagatggccgcgctctccgccaccatcaagagc
gcgagcaaggtgatggtcgtcgactggcatccggaccggctcgctctctgcgagaagatt
ggcgccatccccatcgactactcgaaggtggaccccgtcgagcgggtgaaggaactcacc
aacggcaagggtgccgaccgcggctgcgagtgcgtgggctaccaggcgcacgacccacag
gggagggagcaccccaacctgacgatgaacaatctggtgaaggcggtgaagttcaccggc
ggcatcggcgtggtgggcgtcttcatccccaatgaccccggcggcccggacaccctggcc
aagcagggggaaatcgtcttcgactggggcatgctctggttcaaggggcagcgcgtggcg
accggccagtgcaacgtgaaggcctacaaccgccaactgcgcgagctcatccacctggac
aaggtgaagccctcgtggatcgtctcgcacacgctcccgcttgacaaggcgccggacggc
tacctgaacttcgacaaacgcgacagcggctggaccaaggtcgtcctgcagccggccgcc
tga

DBGET integrated database retrieval system