KEGG   Myxococcus fulvus: LILAB_35290Help
Entry
LILAB_35290       CDS       T01558                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mfu  Myxococcus fulvus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8679118..8680227)
Genome map
AA seq 369 aa AA seqDB search
MIQNRWVSLLSLSAMGVSALAGCERTPPPVAEPVAAPEARKLPAPKPMTPEQLAHFFKPL
PRRKDAPPPPQDTEAQVALGRMLYFEPRLSKNHDVSCNTCHGLTTFGVDNKALSDGHKGL
KGTRNSPTVYNAAGHIAQFWDGRADTLEAQATGPILNPVEMAMPDEKRVVATLTSIPEYT
KRFREAFPGEKKPVTMANAARAIAAFERKLVTTSRFDAFVGGKHDALSEQEQRGLQLFAT
TGCTTCHNGPAVGGTSFQKLGLIEDYPGLKDAGRFDATKNEDDRGKFRVPTLLNVDKTGP
YLHDGSVVELPRMVRLMAKHQLARTLTDAEVDDLVAFLKSLTGELPPAELIAPPELPPST
AKTPKPDPS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattcagaaccggtgggtctcgctgctctcgctgtccgcgatgggcgtcagtgcgctc
gcgggatgtgagcgcacaccgccacccgtcgccgagcccgtggccgcgccggaagcgcgg
aagctgccggcgcccaagccgatgacgcccgagcagctcgcgcacttcttcaagccgctg
ccccggcgcaaggacgcgccgcccccgccccaggacaccgaggcccaggtggcgctgggc
cgcatgctctacttcgagccgcgcctgtccaagaaccacgacgtgtcctgcaacacctgc
cacggcctgacgaccttcggcgtggacaacaaggcgctgtcggacgggcacaaggggctg
aagggcacgcgcaactcgcccaccgtgtacaacgcggcggggcacatcgcgcagttctgg
gacgggcgcgcggacacgctggaggcgcaggccaccgggcccatcctcaacccggtggag
atggccatgccggacgagaagcgcgtggtggccacgctgacctccatcccggagtacacg
aagcgcttccgcgaggccttcccgggggagaagaagcccgtcaccatggccaacgccgcg
cgcgccatcgccgccttcgagcgcaagctcgtcacgacgtcccgcttcgacgccttcgtg
ggcggcaagcacgacgcgctctccgagcaggagcagcggggcctccagctcttcgccacc
accggctgcaccacgtgccacaacggcccggcggtgggcggcacgtccttccagaagctg
ggcctcatcgaggactacccgggcctgaaggacgcgggccgcttcgacgccacgaagaac
gaggatgaccggggcaagttccgcgtgcccacgctcctcaacgtggacaagacggggccg
tacctgcacgacggcagcgtggtggagctgccgcggatggtgcggctgatggcgaagcac
cagctcgcgcgcaccctgacggacgcggaggtggacgacctggtcgccttcctcaagagc
ctcacgggggagttgccccccgccgagctcatcgccccgccggagctgccccccagcacc
gcgaagacgcccaagccggacccgtcttga

DBGET integrated database retrieval system