KEGG   Methanothermus fervidus: Mfer_0003Help
Entry
Mfer_0003         CDS       T01351                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mfv  Methanothermus fervidus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mfv00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mfv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3026..3937)
Genome map
AA seq 303 aa AA seqDB search
MLKLKDIISIRDLEKKDIKLILKVARKMESIARGEKTSNVLEGKVLGMMFYEPSTRTRLS
FEAAMKRLGGKVIGFSEVRTSSTMKGENLADTARTVAQYSDAIVIRHELEGSARYVADLV
EVPVINAGDGAGQHPTQTLLDLYTIKRTFGKINGLHVAILGDLKYGRTVHSLAHALAMFN
VKMSFVSPPELKMPEDIIEDLKNFEVEINETSNLNEVIDDIDVLYVTRIQKERFPDPQEY
SRIKGAYNIDAKTLEGKDLIVMHPLPRVDEISYEVDNLPCAKYFKQAFYGVPVRMAILKL
LIK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattaaaagacattatctctattagagatttagaaaaaaaagatattaaactt
atacttaaggtcgccagaaaaatggaaagtatagcacgtggagagaagacttcaaacgtt
cttgaaggtaaagttttgggcatgatgttctatgaaccatcaactagaactcgtctttca
tttgaagctgccatgaagagattaggaggtaaagtaatcggattttctgaagtaaggaca
agttcaacgatgaaaggtgaaaatttggcagatactgccaggacagtggcacaatattca
gatgctatagtgataagacatgaattagaaggttcagcacgctatgtagcagatcttgtt
gaagttcctgtgataaatgctggtgatggagctggtcaacatcccactcagaccctcctt
gatttatatacaataaaaagaacatttggaaaaataaatgggttacatgttgcaattctt
ggtgatttaaaatatggaagaactgtgcattcattggcacatgccttagcaatgtttaat
gttaaaatgagctttgtttctccacctgaacttaagatgccagaagatatcatagaagat
cttaaaaattttgaagttgaaataaacgaaacttcaaatttgaatgaggttatcgatgat
atagatgtattatatgttacacgtattcaaaaagaaagatttccagatccacaagaatat
tcaagaattaaaggtgcctataacatagatgcaaaaactttggaaggaaaagatttaatt
gttatgcatcctcttccaagggtagatgaaatttcttatgaagtagataatctaccttgc
gcaaaatattttaaacaagccttctatggtgtacctgttaggatggctatattaaaatta
ttaattaaataa

DBGET integrated database retrieval system