KEGG   Methanothermus fervidus: Mfer_0074Help
Entry
Mfer_0074         CDS       T01351                                 

Definition
acetyl-coenzyme a synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0074
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0074
   00620 Pyruvate metabolism
    Mfer_0074
   00640 Propanoate metabolism
    Mfer_0074
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0074
   00680 Methane metabolism
    Mfer_0074
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfer_0074
Lipid biosynthesis proteins [BR:mfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfer_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73760..75643)
Genome map
AA seq 627 aa AA seqDB search
MKENFEDMIIEPPEEIVKRAHVKDWEKEIEKGKDIEEYWKKKAKDFKWFKKWDMVLDDSN
KPFYKWFVNGKTNITYNAVDRWIKTGKRNKVAIIYTSEKEKERKLTYYELYTEVNKMANA
LKRLGVKKGDVVCLYLPMCPELVISMLACAKIGAIHTVVFSGLSVGALEERIRETNAKVV
ITADATFRRGRIIKLKDNVDEAVAKCPSVETIVVVNHANVPVKISELTGREFFYDKLIEG
EDSECPPEKMDAEDPLFILYTSGSTGKPKGVLHTVGGYMVGVSSTLKMVFDIHDDDLYFC
TADIGWITGHSYIVYGPLLLGTTTIIYEGAPDYPDPAIWWRIIEKYGVTKFYTAPTALRH
LRRFGDRHPKKYNLSTLKILGTVGEPIDPETWLWYYKVIGNERCPIMDTWWQTETGMHMI
SPLPTAPLKPGSVTKPLPGIDADIVNKNGDPVKPGEKGYVVIKKPWPAMMRTIYKDEKRY
REYWETIPGYYLATDVGKKDKDSYFWILGRSDDVINISGHRIGTAEVESALISHPDVAEA
AVIGKPDPIKGNVIKAFLVLKNGKKLDVNLMEKIKEHVKHEIGPIAVIGEMEQVDKLPKT
RSGKVMRRILRAKELGEELGDTSTLED
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaattttgaagacatgataatagaaccaccagaagaaattgtaaaaagagca
catgtaaaggattgggaaaaagagattgaaaaaggaaaagacattgaagaatattggaag
aaaaaggctaaagattttaaatggtttaaaaaatgggacatggtattggatgacagcaat
aaacctttttataaatggtttgtgaatggtaaaacaaatatcacatataatgctgtagac
agatggataaaaactggaaaaagaaacaaagttgcaattatttacactagtgaaaaagaa
aaagaacggaaactaacgtattatgagttatacacagaagtaaataaaatggcaaatgcc
ttaaaaagacttggtgtgaaaaaaggcgatgtagtttgtttatatctaccaatgtgccct
gaattagttatatcgatgttagcttgtgcaaagataggtgcaattcatacagtagtgttt
tcaggattaagtgtaggagcattagaagaaagaataagagaaacaaatgcaaaagtagta
ataactgctgatgctacatttagacgaggaaggattataaaacttaaagataatgtggat
gaagctgtagcaaaatgtcctagtgttgaaaccatagtagttgtaaatcatgctaatgta
cctgtaaaaatctcagaattaacaggtagggaatttttctatgataaattaatagaaggt
gaagattcagaatgtcctccagaaaaaatggatgcagaggatccattgtttatcctctat
acttcaggaagcactggtaaaccaaagggtgttctacatacagtcggtggatatatggta
ggtgtaagcagcacactcaaaatggtatttgatattcatgatgatgatctctatttctgt
acagcagacataggatggataacagggcatagttatatagtatatggtcctttactactt
ggaacaacaactataatatatgaaggagcacctgattatccagatcctgcaatatggtgg
agaataattgaaaaatacggtgtaacaaaattttatacagctccaacagcattgagacat
cttcgaaggtttggtgataggcatccaaaaaaatacaatctttctactttaaaaattctt
ggcactgttggagaacccattgatcctgaaacttggttatggtattacaaagttattggt
aatgaaagatgtccaataatggatacttggtggcaaacagaaacaggaatgcacatgata
tctccattgccaactgcaccattaaaaccaggatctgtaacaaaacctcttcctggcatt
gatgcagacattgtaaataagaatggcgatcctgtgaaacctggagaaaaaggttatgtt
gtcataaaaaagccttggccagcaatgatgagaaccatttataaagacgaaaaaaggtat
agagaatattgggaaactattccaggttattatttggcaacagatgtggggaaaaaagat
aaagatagttacttctggattttaggaaggtcagatgatgttataaatatttctggacat
agaattggaactgcagaagtcgaatctgcgttaatttcacatcctgatgttgcagaggct
gcagtaattggtaaacctgatccaattaagggcaatgtcatcaaagcatttttagtttta
aaaaatggtaagaaattagatgtcaatttaatggaaaaaataaaagaacatgtgaaacat
gaaattggaccaatagcagttattggcgaaatggaacaagttgataaattacctaaaact
agaagcggtaaagtcatgaggaggatattaagagctaaagagttaggtgaagagttagga
gatacatctacattagaagattaa

DBGET integrated database retrieval system