KEGG   Methanothermus fervidus: Mfer_0074Help
Entry
Mfer_0074         CDS       T01351                                 

Definition
acetyl-coenzyme a synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mfv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mfv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mfv00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73760..75643)
Genome map
AA seq 627 aa AA seqDB search
MKENFEDMIIEPPEEIVKRAHVKDWEKEIEKGKDIEEYWKKKAKDFKWFKKWDMVLDDSN
KPFYKWFVNGKTNITYNAVDRWIKTGKRNKVAIIYTSEKEKERKLTYYELYTEVNKMANA
LKRLGVKKGDVVCLYLPMCPELVISMLACAKIGAIHTVVFSGLSVGALEERIRETNAKVV
ITADATFRRGRIIKLKDNVDEAVAKCPSVETIVVVNHANVPVKISELTGREFFYDKLIEG
EDSECPPEKMDAEDPLFILYTSGSTGKPKGVLHTVGGYMVGVSSTLKMVFDIHDDDLYFC
TADIGWITGHSYIVYGPLLLGTTTIIYEGAPDYPDPAIWWRIIEKYGVTKFYTAPTALRH
LRRFGDRHPKKYNLSTLKILGTVGEPIDPETWLWYYKVIGNERCPIMDTWWQTETGMHMI
SPLPTAPLKPGSVTKPLPGIDADIVNKNGDPVKPGEKGYVVIKKPWPAMMRTIYKDEKRY
REYWETIPGYYLATDVGKKDKDSYFWILGRSDDVINISGHRIGTAEVESALISHPDVAEA
AVIGKPDPIKGNVIKAFLVLKNGKKLDVNLMEKIKEHVKHEIGPIAVIGEMEQVDKLPKT
RSGKVMRRILRAKELGEELGDTSTLED
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaattttgaagacatgataatagaaccaccagaagaaattgtaaaaagagca
catgtaaaggattgggaaaaagagattgaaaaaggaaaagacattgaagaatattggaag
aaaaaggctaaagattttaaatggtttaaaaaatgggacatggtattggatgacagcaat
aaacctttttataaatggtttgtgaatggtaaaacaaatatcacatataatgctgtagac
agatggataaaaactggaaaaagaaacaaagttgcaattatttacactagtgaaaaagaa
aaagaacggaaactaacgtattatgagttatacacagaagtaaataaaatggcaaatgcc
ttaaaaagacttggtgtgaaaaaaggcgatgtagtttgtttatatctaccaatgtgccct
gaattagttatatcgatgttagcttgtgcaaagataggtgcaattcatacagtagtgttt
tcaggattaagtgtaggagcattagaagaaagaataagagaaacaaatgcaaaagtagta
ataactgctgatgctacatttagacgaggaaggattataaaacttaaagataatgtggat
gaagctgtagcaaaatgtcctagtgttgaaaccatagtagttgtaaatcatgctaatgta
cctgtaaaaatctcagaattaacaggtagggaatttttctatgataaattaatagaaggt
gaagattcagaatgtcctccagaaaaaatggatgcagaggatccattgtttatcctctat
acttcaggaagcactggtaaaccaaagggtgttctacatacagtcggtggatatatggta
ggtgtaagcagcacactcaaaatggtatttgatattcatgatgatgatctctatttctgt
acagcagacataggatggataacagggcatagttatatagtatatggtcctttactactt
ggaacaacaactataatatatgaaggagcacctgattatccagatcctgcaatatggtgg
agaataattgaaaaatacggtgtaacaaaattttatacagctccaacagcattgagacat
cttcgaaggtttggtgataggcatccaaaaaaatacaatctttctactttaaaaattctt
ggcactgttggagaacccattgatcctgaaacttggttatggtattacaaagttattggt
aatgaaagatgtccaataatggatacttggtggcaaacagaaacaggaatgcacatgata
tctccattgccaactgcaccattaaaaccaggatctgtaacaaaacctcttcctggcatt
gatgcagacattgtaaataagaatggcgatcctgtgaaacctggagaaaaaggttatgtt
gtcataaaaaagccttggccagcaatgatgagaaccatttataaagacgaaaaaaggtat
agagaatattgggaaactattccaggttattatttggcaacagatgtggggaaaaaagat
aaagatagttacttctggattttaggaaggtcagatgatgttataaatatttctggacat
agaattggaactgcagaagtcgaatctgcgttaatttcacatcctgatgttgcagaggct
gcagtaattggtaaacctgatccaattaagggcaatgtcatcaaagcatttttagtttta
aaaaatggtaagaaattagatgtcaatttaatggaaaaaataaaagaacatgtgaaacat
gaaattggaccaatagcagttattggcgaaatggaacaagttgataaattacctaaaact
agaagcggtaaagtcatgaggaggatattaagagctaaagagttaggtgaagagttagga
gatacatctacattagaagattaa

DBGET integrated database retrieval system