KEGG   Methanothermus fervidus: Mfer_0074Help
Entry
Mfer_0074         CDS       T01351                                 

Definition
(RefSeq) acetyl-coenzyme a synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0074
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0074
   00620 Pyruvate metabolism
    Mfer_0074
   00640 Propanoate metabolism
    Mfer_0074
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0074
   00680 Methane metabolism
    Mfer_0074
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfer_0074
Lipid biosynthesis proteins [BR:mfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfer_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73760..75643)
Genome map
AA seq 627 aa AA seqDB search
MKENFEDMIIEPPEEIVKRAHVKDWEKEIEKGKDIEEYWKKKAKDFKWFKKWDMVLDDSN
KPFYKWFVNGKTNITYNAVDRWIKTGKRNKVAIIYTSEKEKERKLTYYELYTEVNKMANA
LKRLGVKKGDVVCLYLPMCPELVISMLACAKIGAIHTVVFSGLSVGALEERIRETNAKVV
ITADATFRRGRIIKLKDNVDEAVAKCPSVETIVVVNHANVPVKISELTGREFFYDKLIEG
EDSECPPEKMDAEDPLFILYTSGSTGKPKGVLHTVGGYMVGVSSTLKMVFDIHDDDLYFC
TADIGWITGHSYIVYGPLLLGTTTIIYEGAPDYPDPAIWWRIIEKYGVTKFYTAPTALRH
LRRFGDRHPKKYNLSTLKILGTVGEPIDPETWLWYYKVIGNERCPIMDTWWQTETGMHMI
SPLPTAPLKPGSVTKPLPGIDADIVNKNGDPVKPGEKGYVVIKKPWPAMMRTIYKDEKRY
REYWETIPGYYLATDVGKKDKDSYFWILGRSDDVINISGHRIGTAEVESALISHPDVAEA
AVIGKPDPIKGNVIKAFLVLKNGKKLDVNLMEKIKEHVKHEIGPIAVIGEMEQVDKLPKT
RSGKVMRRILRAKELGEELGDTSTLED
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaattttgaagacatgataatagaaccaccagaagaaattgtaaaaagagca
catgtaaaggattgggaaaaagagattgaaaaaggaaaagacattgaagaatattggaag
aaaaaggctaaagattttaaatggtttaaaaaatgggacatggtattggatgacagcaat
aaacctttttataaatggtttgtgaatggtaaaacaaatatcacatataatgctgtagac
agatggataaaaactggaaaaagaaacaaagttgcaattatttacactagtgaaaaagaa
aaagaacggaaactaacgtattatgagttatacacagaagtaaataaaatggcaaatgcc
ttaaaaagacttggtgtgaaaaaaggcgatgtagtttgtttatatctaccaatgtgccct
gaattagttatatcgatgttagcttgtgcaaagataggtgcaattcatacagtagtgttt
tcaggattaagtgtaggagcattagaagaaagaataagagaaacaaatgcaaaagtagta
ataactgctgatgctacatttagacgaggaaggattataaaacttaaagataatgtggat
gaagctgtagcaaaatgtcctagtgttgaaaccatagtagttgtaaatcatgctaatgta
cctgtaaaaatctcagaattaacaggtagggaatttttctatgataaattaatagaaggt
gaagattcagaatgtcctccagaaaaaatggatgcagaggatccattgtttatcctctat
acttcaggaagcactggtaaaccaaagggtgttctacatacagtcggtggatatatggta
ggtgtaagcagcacactcaaaatggtatttgatattcatgatgatgatctctatttctgt
acagcagacataggatggataacagggcatagttatatagtatatggtcctttactactt
ggaacaacaactataatatatgaaggagcacctgattatccagatcctgcaatatggtgg
agaataattgaaaaatacggtgtaacaaaattttatacagctccaacagcattgagacat
cttcgaaggtttggtgataggcatccaaaaaaatacaatctttctactttaaaaattctt
ggcactgttggagaacccattgatcctgaaacttggttatggtattacaaagttattggt
aatgaaagatgtccaataatggatacttggtggcaaacagaaacaggaatgcacatgata
tctccattgccaactgcaccattaaaaccaggatctgtaacaaaacctcttcctggcatt
gatgcagacattgtaaataagaatggcgatcctgtgaaacctggagaaaaaggttatgtt
gtcataaaaaagccttggccagcaatgatgagaaccatttataaagacgaaaaaaggtat
agagaatattgggaaactattccaggttattatttggcaacagatgtggggaaaaaagat
aaagatagttacttctggattttaggaaggtcagatgatgttataaatatttctggacat
agaattggaactgcagaagtcgaatctgcgttaatttcacatcctgatgttgcagaggct
gcagtaattggtaaacctgatccaattaagggcaatgtcatcaaagcatttttagtttta
aaaaatggtaagaaattagatgtcaatttaatggaaaaaataaaagaacatgtgaaacat
gaaattggaccaatagcagttattggcgaaatggaacaagttgataaattacctaaaact
agaagcggtaaagtcatgaggaggatattaagagctaaagagttaggtgaagagttagga
gatacatctacattagaagattaa

DBGET integrated database retrieval system