KEGG   Methanothermus fervidus: Mfer_0093Help
Entry
Mfer_0093         CDS       T01351                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00260  Glycine, serine and threonine metabolism
mfv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01130  Biosynthesis of antibiotics
mfv01230  Biosynthesis of amino acids
Module
mfv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfer_0093
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfer_0093
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfer_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO ThiG BtpA NanE HMGL-like
Motif
Other DBs
NCBI-ProteinID: ADP76897
UniProt: E3GX08
Position
complement(95927..96754)
Genome map
AA seq 275 aa AA seqDB search
MRYEDYPEMFERLKKKNEGALMPFIVAGYPDLKTSIKIARTLVESGADALEIGFPFSDPI
ADGATIQNANVQALKNKMTVEKGFKLVSKIRKHVKVPIGLLLYYNLVYQKGIYNFYKKAK
NCGVNGILIADLPPEEASDAVKAARKYKLHQIFLIAQTTSNKRLKMISKYSSGFHYLVSV
MGVTGARKKIKKETIDLIKRVKSVSPLPVLVGFGISKPWHVREVINAGADGAIVGSALID
LIGKNIGNPELLNIISRWIKEMKNATRSAIHEKVP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagatatgaagattatcctgagatgtttgaaaggttaaagaaaaaaaatgaaggcgca
ctgatgccatttatagttgctggataccctgatttaaaaacttcaatcaaaattgcaaga
actttggttgaaagcggtgcagatgcattagagataggttttccattttctgatcctata
gcagatggtgctacaatacagaatgcaaatgtacaagctttaaagaataaaatgactgta
gaaaaaggatttaagcttgtatcaaaaattcgtaagcatgttaaagttccaataggttta
ttgttatattataatttagtttatcaaaaaggaatttataatttttataaaaaagctaaa
aattgtggtgtaaatggaatattaatagctgatttgccaccagaagaagcttcagatgct
gtaaaagctgctagaaaatataaactacatcaaatatttctaatagctcaaacgactagt
aataaaagattaaagatgatttctaaatattcttctggctttcattatttagtatctgtt
atgggagtcacaggagctaggaaaaaaataaagaaggaaactatagatttaattaagcgc
gtgaaatcagttagtcctctccctgtcttagttggttttggaatttcaaaaccttggcat
gtaagagaagtaattaatgctggtgcagatggagcaattgttggaagtgctttaattgat
ttaataggtaagaatataggaaatcctgaattgttaaatataatatcaagatggattaaa
gaaatgaaaaacgcaacaaggagtgccatccatgagaaagtaccttaa

DBGET integrated database retrieval system