KEGG   Methanothermus fervidus: Mfer_0094Help
Entry
Mfer_0094         CDS       T01351                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfv  Methanothermus fervidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfer_0094
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfer_0094
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfer_0094
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfer_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(96751..97956)
Genome map
AA seq 401 aa AA seqDB search
MRKNAKGGQMILNTKFGKYGGVFAPELLIPALEELEEAFLRYKDNKKFNKELNYYLREYA
GRPTPLYYAENLSKKLGCKIYLKREDLLHTGAHKINNTLGQGLLAKYMGKSRLIAETGAG
QHGIATATVGALLGMSVDIYMGSEDVERQKLNVFRMEVTGARVIPVDSGSRTLKDAINEA
MRDWIANVEDTHYLIGSSVGPHPYPTMVKHFQSVIGKECKEQILKKEGELPDVIIACVGG
GSNSIGIFAPFIDEDVELIGVEAGGKGLNTGKHGATLCAGKEGILHGSLSYILQDEDGQI
KETYSIAPGLDYPGVGPEHAYLKDIGRVKYVSVNDDEALRGFKLLSKYEGIMPALESAHA
VALAEKYAKKPENKGKTIVINLSGRGDKDMFIVAKALGVEK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaaaatgctaaaggtggtcaaatgattctcaatacaaaatttgggaaatatgga
ggagtatttgcacctgaattattgattccagcattagaggaattagaagaagcattttta
cgatataaagataataaaaagttcaataaggaacttaattattatttaagagaatatgct
gggcggccaactcctctctactatgcggaaaatctttcaaaaaaattaggctgtaaaatt
tatttaaaaagagaagatttactacatacgggtgcacataaaataaataatacacttggg
caaggattacttgcaaaatatatgggtaaaagcagattaatagctgaaactggtgctgga
caacatggaatagccactgcaactgtaggtgctctccttggaatgtcggtggatatatat
atgggttctgaagacgttgaaagacaaaaattaaatgtatttaggatggaagtaacaggt
gcaagagttatacctgtcgattctggatcaagaacattaaaagacgcaataaatgaagcg
atgagagattggattgcgaatgttgaagatacacattatcttattgggtcttctgtagga
ccccacccatatcccacgatggttaagcatttccagagtgttattggtaaggaatgtaaa
gaacaaatacttaaaaaagagggagaactacctgatgtgattattgcgtgtgttggtgga
ggtagtaattctattggaatatttgctccattcattgatgaagatgttgaacttattggt
gttgaagctggtggaaaaggtttaaatacaggaaaacatggagctactctttgtgcaggt
aaagaaggaatacttcatggttctctatcttatatattacaggatgaagacggacagata
aaggagacatattccatagctcctggtttagattatccaggagtaggaccagaacacgca
tatttaaaggatattggcagagtgaaatatgtatcagtcaatgatgatgaagctttaaga
ggttttaaacttttatcaaaatatgaaggaataatgccagcacttgaaagtgcacatgca
gtagctttagctgaaaaatatgcaaagaagccagagaacaagggcaaaacaatagtcata
aacctttctggaagaggagataaagacatgtttatcgtagctaaagctttgggagtggaa
aaatga

DBGET integrated database retrieval system