KEGG   Methanothermus fervidus: Mfer_0157Help
Entry
Mfer_0157         CDS       T01351                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0157
   01230 Biosynthesis of amino acids
    Mfer_0157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0157
   00051 Fructose and mannose metabolism
    Mfer_0157
   00562 Inositol phosphate metabolism
    Mfer_0157
Enzymes [BR:mfv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mfer_0157
Exosome [BR:mfv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mfer_0157
  Exosomal proteins of bladder cancer cells
   Mfer_0157
  Exosomal proteins of melanoma cells
   Mfer_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(155863..156531)
Genome map
AA seq 222 aa AA seqDB search
MDRPIIVLNFKTYKESTGENALKLAKKCEQVSEEYGVKIIVAPQHMDLRYVSENVNIPVI
AQHIDPIDAGGHTGSVLLECAKEAGAKGSLVNHSEKRMKLADISKVVKKLSENDMISIVC
TNNVETSAAAAALSPDFVAVEPPELIGSGIPVSKAKPEVVENTVEAVKTVNPDVRVLCGA
GISSGEDVKKAVELGTEGVLLASGVILAKDQKKALEELITEM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttggatagacctatcatcgtgttaaattttaaaacatacaaagaatctacaggagaaaat
gccctaaaactagcaaaaaaatgcgaacaagtatctgaggaatatggagtaaaaataata
gttgctccacaacatatggacctaagatatgtttcagaaaatgttaacattccagtaata
gcacaacatattgatccaatagatgctggtggacacacaggcagtgtcttattagaatgt
gcaaaagaagcaggtgctaaaggttcgttggtaaatcattcagagaaaagaatgaaattg
gctgacatatcaaaagttgtaaaaaaattatcagagaatgatatgataagcattgtttgt
acaaataatgttgaaactagtgcagctgcagctgcattatctcctgattttgtagcagtt
gaacctcccgaattaataggatcaggcatcccagtgtcaaaagcaaaaccagaagttgtt
gaaaacacagtagaagctgttaaaactgtgaacccggatgttagagtgctatgtggtgca
ggaatatcgtctggtgaagatgtaaaaaaggcagtagaattaggaaccgaaggtgtactt
ttagcttctggtgtaattcttgcaaaggatcaaaagaaagctttagaggaacttataact
gaaatgtag

DBGET integrated database retrieval system