KEGG   Methanothermus fervidus: Mfer_0157Help
Entry
Mfer_0157         CDS       T01351                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mfv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mfv00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mfv00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mfv00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(155863..156531)
Genome map
AA seq 222 aa AA seqDB search
MDRPIIVLNFKTYKESTGENALKLAKKCEQVSEEYGVKIIVAPQHMDLRYVSENVNIPVI
AQHIDPIDAGGHTGSVLLECAKEAGAKGSLVNHSEKRMKLADISKVVKKLSENDMISIVC
TNNVETSAAAAALSPDFVAVEPPELIGSGIPVSKAKPEVVENTVEAVKTVNPDVRVLCGA
GISSGEDVKKAVELGTEGVLLASGVILAKDQKKALEELITEM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttggatagacctatcatcgtgttaaattttaaaacatacaaagaatctacaggagaaaat
gccctaaaactagcaaaaaaatgcgaacaagtatctgaggaatatggagtaaaaataata
gttgctccacaacatatggacctaagatatgtttcagaaaatgttaacattccagtaata
gcacaacatattgatccaatagatgctggtggacacacaggcagtgtcttattagaatgt
gcaaaagaagcaggtgctaaaggttcgttggtaaatcattcagagaaaagaatgaaattg
gctgacatatcaaaagttgtaaaaaaattatcagagaatgatatgataagcattgtttgt
acaaataatgttgaaactagtgcagctgcagctgcattatctcctgattttgtagcagtt
gaacctcccgaattaataggatcaggcatcccagtgtcaaaagcaaaaccagaagttgtt
gaaaacacagtagaagctgttaaaactgtgaacccggatgttagagtgctatgtggtgca
ggaatatcgtctggtgaagatgtaaaaaaggcagtagaattaggaaccgaaggtgtactt
ttagcttctggtgtaattcttgcaaaggatcaaaagaaagctttagaggaacttataact
gaaatgtag

DBGET integrated database retrieval system