KEGG   Methanothermus fervidus: Mfer_0157Help
Entry
Mfer_0157         CDS       T01351                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0157
   01230 Biosynthesis of amino acids
    Mfer_0157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0157
   00051 Fructose and mannose metabolism
    Mfer_0157
   00562 Inositol phosphate metabolism
    Mfer_0157
Enzymes [BR:mfv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mfer_0157
Exosome [BR:mfv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mfer_0157
  Exosomal proteins of bladder cancer cells
   Mfer_0157
  Exosomal proteins of melanoma cells
   Mfer_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(155863..156531)
Genome map
AA seq 222 aa AA seqDB search
MDRPIIVLNFKTYKESTGENALKLAKKCEQVSEEYGVKIIVAPQHMDLRYVSENVNIPVI
AQHIDPIDAGGHTGSVLLECAKEAGAKGSLVNHSEKRMKLADISKVVKKLSENDMISIVC
TNNVETSAAAAALSPDFVAVEPPELIGSGIPVSKAKPEVVENTVEAVKTVNPDVRVLCGA
GISSGEDVKKAVELGTEGVLLASGVILAKDQKKALEELITEM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttggatagacctatcatcgtgttaaattttaaaacatacaaagaatctacaggagaaaat
gccctaaaactagcaaaaaaatgcgaacaagtatctgaggaatatggagtaaaaataata
gttgctccacaacatatggacctaagatatgtttcagaaaatgttaacattccagtaata
gcacaacatattgatccaatagatgctggtggacacacaggcagtgtcttattagaatgt
gcaaaagaagcaggtgctaaaggttcgttggtaaatcattcagagaaaagaatgaaattg
gctgacatatcaaaagttgtaaaaaaattatcagagaatgatatgataagcattgtttgt
acaaataatgttgaaactagtgcagctgcagctgcattatctcctgattttgtagcagtt
gaacctcccgaattaataggatcaggcatcccagtgtcaaaagcaaaaccagaagttgtt
gaaaacacagtagaagctgttaaaactgtgaacccggatgttagagtgctatgtggtgca
ggaatatcgtctggtgaagatgtaaaaaaggcagtagaattaggaaccgaaggtgtactt
ttagcttctggtgtaattcttgcaaaggatcaaaagaaagctttagaggaacttataact
gaaatgtag

DBGET integrated database retrieval system