KEGG   Methanothermus fervidus: Mfer_0189Help
Entry
Mfer_0189         CDS       T01351                                 

Definition
(RefSeq) cytidine kinase (EC:2.7.1.73 2.7.1.-)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
mfv  Methanothermus fervidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mfer_0189
Enzymes [BR:mfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mfer_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189741..190661)
Genome map
AA seq 306 aa AA seqDB search
MTIDILAVGHTAFDYIMQVEDFPSPNSSVKVEKLENLHGGAAANVAVAVQKLGFKSGLVS
AVGEDFKKTEYYEKLKKMNINMEGIIEIENYKTPRAFVVTNSKNDQISYFYWGAAEKFED
LDPPKEVIKKAKIIHLATGNPKFNIRCGKIAKKYNKIVSADPGQDLYLYSSKNLKEMLST
CDILFGNHHEIRKIKKKTNEKDLRKLGPKIVVETYGKEGSIIHSKNMIKIKALGRKVVDP
TGAGDSYRAGFLVSYLKGNDLETCGKFATTVASFVIESEGSQTNLPTFEDVKYRYEKHWG
KLKFLE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgacaatcgatattcttgcggttggacatacagcatttgattatattatgcaagtggaa
gattttccatcgccaaattcttcagtaaaggttgaaaaattagaaaatttacatggtggt
gcagctgcaaatgttgcagttgcagttcaaaaattaggatttaaatcaggacttgtgtca
gcagttggagaagactttaaaaaaacagaatattatgaaaaattaaaaaagatgaatata
aatatggaaggaataatagaaatagaaaattataaaacaccaagagcttttgttgttacg
aactcaaaaaacgatcaaattagttatttttattggggtgcggctgaaaaatttgaagat
ttagatccgccaaaagaagttataaaaaaagctaaaattattcatttagcaactggtaat
ccaaaatttaatattcgttgcggtaaaattgcaaaaaaatataacaaaatagtttctgct
gatcctggtcaagacctttacttatattcatcaaaaaatttgaaggaaatgttaagtact
tgtgatattctctttggtaatcatcatgaaattaggaagataaagaaaaaaactaatgaa
aaagatttaagaaagttaggtcctaaaattgtagttgaaacttatggtaaagaaggtagt
attattcattcaaaaaatatgataaaaataaaagctttaggtagaaaagttgttgatcca
actggagcaggagattcgtacagagcaggatttctagtatcatatctgaaaggaaatgac
cttgaaacttgtggaaaatttgcaacaacagtagcatcgtttgtaatagagtctgaaggt
tcccaaaccaacttaccaacatttgaagatgttaaatatcgttatgagaagcattggggc
aaactaaaatttttggagtga

DBGET integrated database retrieval system