KEGG   Methanothermus fervidus: Mfer_0260Help
Entry
Mfer_0260         CDS       T01351                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00010  Glycolysis / Gluconeogenesis
mfv00020  Citrate cycle (TCA cycle)
mfv00620  Pyruvate metabolism
mfv00633  Nitrotoluene degradation
mfv00640  Propanoate metabolism
mfv00650  Butanoate metabolism
mfv00680  Methane metabolism
mfv00720  Carbon fixation pathways in prokaryotes
mfv01100  Metabolic pathways
mfv01120  Microbial metabolism in diverse environments
mfv01130  Biosynthesis of antibiotics
mfv01200  Carbon metabolism
Module
mfv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0260
   00020 Citrate cycle (TCA cycle)
    Mfer_0260
   00620 Pyruvate metabolism
    Mfer_0260
   00640 Propanoate metabolism
    Mfer_0260
   00650 Butanoate metabolism
    Mfer_0260
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0260
   00680 Methane metabolism
    Mfer_0260
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mfer_0260
Enzymes [BR:mfv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mfer_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADP77063
UniProt: E3GXN1
Position
252563..253090
Genome map
AA seq 175 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAAFYDGKYSQAFPFFGVERRGAPVLAFVRIDNKPIRI
RYQVYKPNYVIVLDDKLVESVDVFKGLHEPAVVVINSKNEIKKEGVKIYSVDATNIALET
LGSPIVNTAMLGAFVGATKIIKLDSLIKAIKNSFKDKIGEKNAKAAVKGYESVVG
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattagattccatggacgaggaggtcagggggctgtcactgctgccgaaatt
ttagcaaaggctgcattttacgatggtaaatattcccaggcatttccgttttttggtgta
gagaggagaggcgcacctgtgttggcttttgttagaattgataataaacccataagaata
agatatcaagtttacaagcctaattatgtgattgttttagatgataaattagttgaaagt
gtagatgtatttaaaggtttacatgaacctgctgttgtggttataaattctaaaaatgaa
attaaaaaagaaggtgttaaaatttattctgtagatgctacaaatatagctttagaaact
cttggcagccccatagttaatactgcaatgttaggtgcatttgtaggtgcaacaaaaata
ataaaacttgattccctcataaaagcgattaaaaatagttttaaagataaaataggagaa
aaaaatgctaaagcagctgtaaaaggctatgagagcgttgtagggtga

DBGET integrated database retrieval system