KEGG   Methanothermus fervidus: Mfer_0263Help
Entry
Mfer_0263         CDS       T01351                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0263
   00020 Citrate cycle (TCA cycle)
    Mfer_0263
   00620 Pyruvate metabolism
    Mfer_0263
   00640 Propanoate metabolism
    Mfer_0263
   00650 Butanoate metabolism
    Mfer_0263
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0263
   00680 Methane metabolism
    Mfer_0263
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mfer_0263
Enzymes [BR:mfv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mfer_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254489..255349
Genome map
AA seq 286 aa AA seqDB search
MNEKELLAPGHRGCAGCGAAIGVKLALRVLGKNTIAVTPTGCLEVMTSPYPETAWRIPWI
HVAFENAAAVAAGVESALKAKGKDDINVVVFAGDGGTVDIGMQALSGAMERGHNIIYVCY
DNEAYMNTGIQRSGATPFGASTTTTPPGKKSFGENKQKKNMALIMAAHEIPYVATASISY
PEDYMRKVKKAMEIDRPSYIHLHQPCTTGWRFPPSKTIEVGRLAVESGAWLLYEIENGEF
RITYRPVERRPVKEYLKMQGRFKHLTDEEIQKIQDYIDEVCSKLRI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaagaattgttggcaccaggacatagaggatgtgcaggttgcggtgccgcc
attggtgtcaaattagctttgagagtattaggcaaaaataccattgctgttactcctaca
ggttgtttagaagtcatgacatccccataccctgaaacagcatggagaataccatggatt
cacgttgcatttgaaaatgcagccgcagtagctgcaggagttgaaagtgcattgaaggcc
aaaggtaaagatgacattaatgttgtagtttttgcaggagacggtgggacagttgatatt
ggaatgcaggcattgtcaggagcaatggaaagaggtcataatataatttacgtttgttat
gataacgaagcttatatgaacaccggtatacaaagaagtggtgcaacgccttttggggca
tctactactacaacgccacctggaaaaaaaagttttggtgaaaataaacaaaaaaagaat
atggcattaataatggcagcacatgagataccttatgtagctacagcttctatatcttat
cctgaagattatatgagaaaagtaaaaaaggctatggagatagataggccatcatatatt
cacttgcatcaaccatgtacaactggttggagatttccaccttcaaaaactatagaagtt
ggaagattagcagtggaaagtggagcatggttgttatatgaaatagaaaatggtgaattt
aggataacttacagaccagtggaaagacggccggttaaagaatatttgaagatgcaggga
agatttaaacatttaacagatgaagagatacaaaaaatccaagattacatcgatgaagtt
tgttctaagttaagaatatga

DBGET integrated database retrieval system