KEGG   Methanothermus fervidus: Mfer_0276Help
Entry
Mfer_0276         CDS       T01351                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00010  Glycolysis / Gluconeogenesis
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01120  Microbial metabolism in diverse environments
mfv01130  Biosynthesis of antibiotics
mfv01200  Carbon metabolism
mfv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0276
Enzymes [BR:mfv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mfer_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP NAD_binding_3 Semialdhyde_dh GFO_IDH_MocA DUF348 F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADP77079
UniProt: E3GXP7
Structure
PDB: 

Jmol
Position
266328..267341
Genome map
AA seq 337 aa AA seqDB search
MKAVAINGYGTVGKRVADAIAQQDDMKVIGVSKTRPDFEARMALKKGYDLYVAIPERVKL
FEKAGIEVAGTVDDMLDEADIVIDCTPEGIGAKNLKMYKEKGIKAIFQGGEKHEDIGLSF
NSLSNYEESYGKDYTRVVSCNTTGLCRTLKPLHDSFGIKKVRAVIVRRGADPAQVSKGPI
NAIIPNPPKLPSHHGPDVKTVLDINIDTMAVIVPTTLMHQHNVMVEVEETPTVDDIIDVF
EDTPRVILISAEDGLTSTAEIMEYAKELGRSRNDLFEIPVWRESITVVDNEIYYMQAVHQ
ESDIVPENVDAVRAILEMEEDKYKSINKTNKAMNILQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtagctattaatgggtatggaactgtaggtaaaagagttgcagatgcaatt
gcacaacaagatgatatgaaagttatcggagtaagtaagacaagaccagattttgaagct
aggatggcactaaaaaagggttatgatttatatgttgctattcctgaaagggtaaaatta
tttgaaaaggcaggaattgaagttgcaggaacagtggatgacatgctagatgaagcagat
atagttattgattgtactccagaaggaattggtgccaaaaatttaaaaatgtataaagaa
aaaggaataaaagctatatttcaaggtggagaaaaacatgaagatataggtttatcattc
aattcattgagcaattatgaagaatcttatggcaaagactacacacgagttgtttcctgt
aataccactggtttatgcagaactttaaaaccattacatgattcttttggtataaaaaaa
gttagagccgtaatagtaaggagaggtgcagaccctgcacaagtatctaaaggacctata
aacgctataatacccaatccacctaaattaccatctcaccatggtccagatgttaaaaca
gtcctggacataaatatagatacaatggctgttatagtaccaactactttaatgcatcaa
cataacgttatggtagaggtggaagaaactcctactgtggatgatataatagatgtattt
gaagatacgcctagagttatacttataagtgctgaggatggtttgacatcaactgcagag
ataatggaatatgcaaaggaattaggtagatccagaaacgatttatttgaaattcctgtt
tggagagaatcaataactgtcgtagacaatgaaatttattacatgcaagcagttcatcaa
gaatcagatatagtacctgaaaatgtagatgctgtaagagcaatattagagatggaagag
gataaatacaaatctataaataaaactaacaaagcaatgaacatacttcaataa

DBGET integrated database retrieval system