KEGG   Methanothermus fervidus: Mfer_0308Help
Entry
Mfer_0308         CDS       T01351                                 

Definition
pfkb domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mfv  Methanothermus fervidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mfer_0308
Enzymes [BR:mfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mfer_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296684..297538
Genome map
AA seq 284 aa AA seqDB search
MDLDVVSIGSCNMDIILRVPSFVEPDSEMYVEKIYMQPGGPAFNFAVNMARLKFNTWIIA
RIGMDRFGEIIKKTLKKEGVNIEYLQESEIPTGVAFISVDKKGRRSVYSYMGANATLDFS
KKDIKRIKTADVVYLSGTYWETALKVSKRANIFIYNPGSIIANFGTKTLSKIFKHTYILF
ANEKELKKLTNLNIEKGARILLDLGVKIVVITRGKKDAIAITENKIVRCPAKKLKVVDTT
GAGDAFAAGFIAKWLKNENLKNCLRFGHQKAAQCIKNYGSMQLS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggatttagatgttgtaagtattggaagctgtaatatggatattattttaagagtacca
tcatttgtagagccagacagtgaaatgtatgtagaaaaaatatatatgcaaccaggtggc
cctgcttttaattttgcagttaacatggctcgtttaaaatttaatacatggataatagca
agaataggcatggacagatttggagagataattaaaaaaactcttaaaaaagaaggtgtg
aatatcgaatatttacaggaatcagaaattcctacaggtgtagcatttattagtgtagat
aaaaaaggtagaagatctgtatattcatatatgggtgcaaatgcaacattagatttcagt
aaaaaagatattaaacgtatcaaaactgctgatgtagtatatttatctggaacttattgg
gaaactgcactaaaagtttctaaaagagcaaacatttttatctataatccaggatctatt
atagcgaactttggaacaaaaacattgtcaaaaattttcaagcacacctatattttgttt
gcaaatgaaaaagaattgaaaaaacttacaaatttaaatattgaaaaaggtgctagaatt
ttactagatttaggtgtgaagattgttgtaattacaagaggaaaaaaggatgcaattgca
ataacagaaaataaaatagttagatgcccagcaaaaaaattaaaggttgtagatacaaca
ggagccggcgatgcatttgcggcaggatttatagctaaatggctaaaaaatgaaaattta
aaaaattgtttaagatttgggcatcaaaaagcagctcaatgtataaaaaattatggatca
atgcaattatcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system