KEGG   Methanothermus fervidus: Mfer_0415Help
Entry
Mfer_0415         CDS       T01351                                 

Definition
(RefSeq) amp-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0415
   00620 Pyruvate metabolism
    Mfer_0415
   00640 Propanoate metabolism
    Mfer_0415
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0415
   00680 Methane metabolism
    Mfer_0415
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfer_0415
Lipid biosynthesis proteins [BR:mfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfer_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400880..402574
Genome map
AA seq 564 aa AA seqDB search
MASLLNEFVNRVNFESYEDFKKNFKIIVPDNFNFAYDVVDRYAEEVPGKRALVWCDDNGN
EKILNFADMKLQSDKVANFLRNLGVKKGDKVMLTLKGRYEFWFSLLALHKIGAIAVPATH
MLREKDIVYRIKKAGIDTVISVDDKDLIESYESAEKKLGVELKKIIVGNERDGWLNFREE
VKKTPSNFKKPEGDKYPSGNDISLIYFSSGTTGMPKMIQHDFNYPLAHIITAKYWQNVRE
GGLHYTLSDTGWAKSVWGQIYGQWIAGSAVFVYDFDRFDPHKVLKKIEKYKINTFCAPPT
VYRFFIKQDLSKYDLSSIEHAVTAGEPLNPEVFKKFYEETGIKIMEGFGQTECTLCIANF
IWMEPKPGSMGKPSPLYDVKVVDKEGNEVDIGEEGEIAIDTSDGRPLGLFLGYYKDPEKT
KKAWHNDLYHTGDTAWVDEDGYFWFVGRNDDVINSSGYRIGPFEVESAIISHPAVLECAV
TGYPDPIRGQVVKATIVLTDGYEPSEKLKKEIQEHVKKVTAPYKYPRIIEFVDELPKTIS
GKIKRAEIRKRDEMRYKKEQQKKL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcatctttactcaatgaatttgtaaatagagtaaattttgaatcttacgaagatttc
aagaaaaattttaaaataatagttccagataatttcaattttgcatatgacgtagttgac
agatatgctgaggaagtacctggaaaaagggctcttgtatggtgcgatgacaacgggaat
gaaaagatattaaattttgcggatatgaaattacaatcagacaaagttgctaacttttta
cgaaatttaggtgtgaaaaaaggcgataaagtaatgctaactcttaaaggaagatatgaa
ttttggttttcattgttagccttacataaaataggagctatagctgtacctgctacccat
atgctcagagaaaaggatatagtatatcgtataaaaaaagcaggtatagacacagttatc
tctgtagatgataaagacttaattgagtcttatgaaagcgctgaaaaaaaattaggtgta
gaactcaagaaaattatagtaggaaatgaaagagatggatggttaaacttcagggaagaa
gttaagaaaacaccttcaaactttaaaaaaccagaaggtgacaagtatccttcagggaat
gacatatctcttatctatttttcttcgggtactactggaatgccaaagatgatccaacat
gatttcaactatccacttgcacatataataacagcaaaatattggcaaaatgttcgtgaa
ggtggattacattatacattgtcagacacaggttgggcaaaatctgtctggggacaaata
tatggtcaatggatagccggaagtgcagtatttgtttatgattttgataggtttgatccc
cacaaagtattgaagaaaattgaaaaatataaaattaatactttttgtgcacctcctaca
gtatatagattcttcataaagcaagatttatccaaatatgatttatccagtatagaacat
gctgtaactgctggtgagcctttaaacccagaagtatttaaaaaattttatgaagagact
ggaattaaaatcatggaagggtttggacagacagaatgtactttatgtatagccaacttc
atttggatggaaccaaaaccaggatctatgggtaagccatcgccactttacgatgtaaaa
gttgttgacaaagaaggcaatgaagtagacattggagaagaaggagaaatagcaattgat
acttctgatggtaggcctttaggactatttctaggctattataaagatcctgaaaaaaca
aaaaaagcatggcataatgatttgtatcacacaggagatacagcatgggtagatgaagat
ggatacttttggtttgttggaagaaacgatgacgtaataaatagttcaggatatcgtata
ggtccgtttgaagtagaaagtgctattatttcacatcctgcagttcttgaatgtgcagtg
actggttatccagatccaattagaggtcaggttgtaaaagcaactatagtattaactgat
ggatatgaaccatctgaaaaactaaaaaaggaaattcaagaacatgtaaagaaagttaca
gcgccatataaatatccaagaataattgagtttgtcgatgaattaccaaagactattagt
ggtaaaatcaagagggccgaaataaggaaaagagacgagatgagatataaaaaagaacaa
caaaagaaattatga

DBGET integrated database retrieval system