KEGG   Methanothermus fervidus: Mfer_0415Help
Entry
Mfer_0415         CDS       T01351                                 

Definition
amp-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0415
   00620 Pyruvate metabolism
    Mfer_0415
   00640 Propanoate metabolism
    Mfer_0415
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0415
   00680 Methane metabolism
    Mfer_0415
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfer_0415
Lipid biosynthesis proteins [BR:mfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfer_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400880..402574
Genome map
AA seq 564 aa AA seqDB search
MASLLNEFVNRVNFESYEDFKKNFKIIVPDNFNFAYDVVDRYAEEVPGKRALVWCDDNGN
EKILNFADMKLQSDKVANFLRNLGVKKGDKVMLTLKGRYEFWFSLLALHKIGAIAVPATH
MLREKDIVYRIKKAGIDTVISVDDKDLIESYESAEKKLGVELKKIIVGNERDGWLNFREE
VKKTPSNFKKPEGDKYPSGNDISLIYFSSGTTGMPKMIQHDFNYPLAHIITAKYWQNVRE
GGLHYTLSDTGWAKSVWGQIYGQWIAGSAVFVYDFDRFDPHKVLKKIEKYKINTFCAPPT
VYRFFIKQDLSKYDLSSIEHAVTAGEPLNPEVFKKFYEETGIKIMEGFGQTECTLCIANF
IWMEPKPGSMGKPSPLYDVKVVDKEGNEVDIGEEGEIAIDTSDGRPLGLFLGYYKDPEKT
KKAWHNDLYHTGDTAWVDEDGYFWFVGRNDDVINSSGYRIGPFEVESAIISHPAVLECAV
TGYPDPIRGQVVKATIVLTDGYEPSEKLKKEIQEHVKKVTAPYKYPRIIEFVDELPKTIS
GKIKRAEIRKRDEMRYKKEQQKKL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcatctttactcaatgaatttgtaaatagagtaaattttgaatcttacgaagatttc
aagaaaaattttaaaataatagttccagataatttcaattttgcatatgacgtagttgac
agatatgctgaggaagtacctggaaaaagggctcttgtatggtgcgatgacaacgggaat
gaaaagatattaaattttgcggatatgaaattacaatcagacaaagttgctaacttttta
cgaaatttaggtgtgaaaaaaggcgataaagtaatgctaactcttaaaggaagatatgaa
ttttggttttcattgttagccttacataaaataggagctatagctgtacctgctacccat
atgctcagagaaaaggatatagtatatcgtataaaaaaagcaggtatagacacagttatc
tctgtagatgataaagacttaattgagtcttatgaaagcgctgaaaaaaaattaggtgta
gaactcaagaaaattatagtaggaaatgaaagagatggatggttaaacttcagggaagaa
gttaagaaaacaccttcaaactttaaaaaaccagaaggtgacaagtatccttcagggaat
gacatatctcttatctatttttcttcgggtactactggaatgccaaagatgatccaacat
gatttcaactatccacttgcacatataataacagcaaaatattggcaaaatgttcgtgaa
ggtggattacattatacattgtcagacacaggttgggcaaaatctgtctggggacaaata
tatggtcaatggatagccggaagtgcagtatttgtttatgattttgataggtttgatccc
cacaaagtattgaagaaaattgaaaaatataaaattaatactttttgtgcacctcctaca
gtatatagattcttcataaagcaagatttatccaaatatgatttatccagtatagaacat
gctgtaactgctggtgagcctttaaacccagaagtatttaaaaaattttatgaagagact
ggaattaaaatcatggaagggtttggacagacagaatgtactttatgtatagccaacttc
atttggatggaaccaaaaccaggatctatgggtaagccatcgccactttacgatgtaaaa
gttgttgacaaagaaggcaatgaagtagacattggagaagaaggagaaatagcaattgat
acttctgatggtaggcctttaggactatttctaggctattataaagatcctgaaaaaaca
aaaaaagcatggcataatgatttgtatcacacaggagatacagcatgggtagatgaagat
ggatacttttggtttgttggaagaaacgatgacgtaataaatagttcaggatatcgtata
ggtccgtttgaagtagaaagtgctattatttcacatcctgcagttcttgaatgtgcagtg
actggttatccagatccaattagaggtcaggttgtaaaagcaactatagtattaactgat
ggatatgaaccatctgaaaaactaaaaaaggaaattcaagaacatgtaaagaaagttaca
gcgccatataaatatccaagaataattgagtttgtcgatgaattaccaaagactattagt
ggtaaaatcaagagggccgaaataaggaaaagagacgagatgagatataaaaaagaacaa
caaaagaaattatga

DBGET integrated database retrieval system