KEGG   Methanothermus fervidus: Mfer_0415Help
Entry
Mfer_0415         CDS       T01351                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00010  Glycolysis / Gluconeogenesis
mfv00620  Pyruvate metabolism
mfv00640  Propanoate metabolism
mfv00680  Methane metabolism
mfv00720  Carbon fixation pathways in prokaryotes
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01120  Microbial metabolism in diverse environments
mfv01130  Biosynthesis of antibiotics
mfv01200  Carbon metabolism
Module
mfv_M00357  Methanogenesis, acetate => methane
mfv_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0415
   00620 Pyruvate metabolism
    Mfer_0415
   00640 Propanoate metabolism
    Mfer_0415
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mfer_0415
   00680 Methane metabolism
    Mfer_0415
Enzymes [BR:mfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfer_0415
Lipid biosynthesis proteins [BR:mfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfer_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF1967
Motif
Other DBs
NCBI-ProteinID: ADP77217
UniProt: E3GY35
Position
400880..402574
Genome map
AA seq 564 aa AA seqDB search
MASLLNEFVNRVNFESYEDFKKNFKIIVPDNFNFAYDVVDRYAEEVPGKRALVWCDDNGN
EKILNFADMKLQSDKVANFLRNLGVKKGDKVMLTLKGRYEFWFSLLALHKIGAIAVPATH
MLREKDIVYRIKKAGIDTVISVDDKDLIESYESAEKKLGVELKKIIVGNERDGWLNFREE
VKKTPSNFKKPEGDKYPSGNDISLIYFSSGTTGMPKMIQHDFNYPLAHIITAKYWQNVRE
GGLHYTLSDTGWAKSVWGQIYGQWIAGSAVFVYDFDRFDPHKVLKKIEKYKINTFCAPPT
VYRFFIKQDLSKYDLSSIEHAVTAGEPLNPEVFKKFYEETGIKIMEGFGQTECTLCIANF
IWMEPKPGSMGKPSPLYDVKVVDKEGNEVDIGEEGEIAIDTSDGRPLGLFLGYYKDPEKT
KKAWHNDLYHTGDTAWVDEDGYFWFVGRNDDVINSSGYRIGPFEVESAIISHPAVLECAV
TGYPDPIRGQVVKATIVLTDGYEPSEKLKKEIQEHVKKVTAPYKYPRIIEFVDELPKTIS
GKIKRAEIRKRDEMRYKKEQQKKL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcatctttactcaatgaatttgtaaatagagtaaattttgaatcttacgaagatttc
aagaaaaattttaaaataatagttccagataatttcaattttgcatatgacgtagttgac
agatatgctgaggaagtacctggaaaaagggctcttgtatggtgcgatgacaacgggaat
gaaaagatattaaattttgcggatatgaaattacaatcagacaaagttgctaacttttta
cgaaatttaggtgtgaaaaaaggcgataaagtaatgctaactcttaaaggaagatatgaa
ttttggttttcattgttagccttacataaaataggagctatagctgtacctgctacccat
atgctcagagaaaaggatatagtatatcgtataaaaaaagcaggtatagacacagttatc
tctgtagatgataaagacttaattgagtcttatgaaagcgctgaaaaaaaattaggtgta
gaactcaagaaaattatagtaggaaatgaaagagatggatggttaaacttcagggaagaa
gttaagaaaacaccttcaaactttaaaaaaccagaaggtgacaagtatccttcagggaat
gacatatctcttatctatttttcttcgggtactactggaatgccaaagatgatccaacat
gatttcaactatccacttgcacatataataacagcaaaatattggcaaaatgttcgtgaa
ggtggattacattatacattgtcagacacaggttgggcaaaatctgtctggggacaaata
tatggtcaatggatagccggaagtgcagtatttgtttatgattttgataggtttgatccc
cacaaagtattgaagaaaattgaaaaatataaaattaatactttttgtgcacctcctaca
gtatatagattcttcataaagcaagatttatccaaatatgatttatccagtatagaacat
gctgtaactgctggtgagcctttaaacccagaagtatttaaaaaattttatgaagagact
ggaattaaaatcatggaagggtttggacagacagaatgtactttatgtatagccaacttc
atttggatggaaccaaaaccaggatctatgggtaagccatcgccactttacgatgtaaaa
gttgttgacaaagaaggcaatgaagtagacattggagaagaaggagaaatagcaattgat
acttctgatggtaggcctttaggactatttctaggctattataaagatcctgaaaaaaca
aaaaaagcatggcataatgatttgtatcacacaggagatacagcatgggtagatgaagat
ggatacttttggtttgttggaagaaacgatgacgtaataaatagttcaggatatcgtata
ggtccgtttgaagtagaaagtgctattatttcacatcctgcagttcttgaatgtgcagtg
actggttatccagatccaattagaggtcaggttgtaaaagcaactatagtattaactgat
ggatatgaaccatctgaaaaactaaaaaaggaaattcaagaacatgtaaagaaagttaca
gcgccatataaatatccaagaataattgagtttgtcgatgaattaccaaagactattagt
ggtaaaatcaagagggccgaaataaggaaaagagacgagatgagatataaaaaagaacaa
caaaagaaattatga

DBGET integrated database retrieval system