KEGG   Methanothermus fervidus: Mfer_0547Help
Entry
Mfer_0547         CDS       T01351                                 

Definition
phosphomannomutase (EC:5.4.2.10 5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0547
   00030 Pentose phosphate pathway
    Mfer_0547
   00051 Fructose and mannose metabolism
    Mfer_0547
   00052 Galactose metabolism
    Mfer_0547
   00500 Starch and sucrose metabolism
    Mfer_0547
   00520 Amino sugar and nucleotide sugar metabolism
    Mfer_0547
  Nucleotide metabolism
   00230 Purine metabolism
    Mfer_0547
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mfer_0547
Enzymes [BR:mfv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mfer_0547
    5.4.2.8  phosphomannomutase
     Mfer_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532959..534314
Genome map
AA seq 451 aa AA seqDB search
MGKLFGTFGVRKIANKGLTPEFASKLACAYGSLVDGKIAVGGDTRTSTIMIKHAVIAGLL
SSGCDVVDLGILPTPAVQYAVRNYYDGGVIITASHNPPQYNGIKFVDEDGIGIPKNMEDK
VENLFFKNKFKRVKWENIGKIENVDILDEYKNEIIKRVNKDVIEDSNIKVVVDAGCGAAS
YVTPYVLRELGCEVITLNCQPDGFFPGRNPEPTEENLKDLMKTVKAVGADIGIAHDGDAD
RTICIDENGNFVYGDKTFALVEKKMLQDNGGGLIVTTVATSSVIYDVAEEYGGEVVTTPV
GDLLVARELKRRNGLFGGEENGGLIFPDFVYGRDGALSAAKIVEIMAEEKKPLSKLVAEL
PQYYSEKEKVECPEEMKDEVLKKLLEKVENDPSVKNIDTTDGVKVFKDEGWVIMRPSGTE
PIFRCFAESKNKEDAKKLVKWGIKLIKECKT
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggggaaattatttggaacatttggtgtaagaaaaatagcaaacaaaggattaacacca
gaatttgcatcaaagttagcttgtgcctatggatcattagttgatggtaaaatagcagtt
ggtggagatacaagaacttctacaatcatgatcaaacacgcagtaatagcaggtttactt
tctagtggttgtgatgttgtagatcttggtattttacctacaccagcagtccaatatgct
gtaagaaattattatgatggtggagttattataactgcttcacataatcctcctcaatat
aatggaataaaatttgtagatgaagatggaataggtataccaaaaaatatggaagataaa
gttgaaaatttgttttttaagaacaaatttaagagagttaaatgggaaaacattggtaag
atagaaaatgtggatatacttgatgaatacaagaacgaaatcataaagagagttaacaaa
gatgtaatagaggattcaaacataaaagttgtagtggatgctggttgtggagctgcatct
tatgtaaccccttatgtcttaagagaacttggatgtgaagtaattactttaaattgtcag
ccagatggatttttcccaggtagaaatccagagcctacagaagaaaatttaaaagatcta
atgaagactgttaaggcagttggagcagatattggaattgcacatgatggggacgctgat
aggactatatgtatagacgagaatggaaattttgtttatggtgacaaaacatttgcacta
gtggaaaaaaagatgttacaagataatggcggtggattgattgtaacaacggttgcaact
tcatcagttatatatgatgtagcagaagagtatggtggagaggttgtaacaacgcctgtt
ggagatctattagttgctagagaattaaaaagaagaaatggtttgtttggcggagaagaa
aacggaggacttatatttccagactttgtatatgggcgagatggagcactttcagctgct
aaaatagttgaaataatggcagaagagaaaaaaccactttcaaaacttgttgcagaactt
ccacaatattattcagaaaaagagaaagttgagtgtccagaagaaatgaaagacgaggta
ctgaaaaaattgttggagaaggttgaaaatgacccatctgtgaaaaatatagatacaact
gatggtgttaaagtatttaaggatgaaggctgggtaatcatgcgtccatctggcactgag
cctatatttagatgttttgctgaaagtaaaaacaaagaagatgcaaaaaaattagttaaa
tggggaattaaattaattaaggaatgtaaaacttaa

DBGET integrated database retrieval system