KEGG   Methanothermus fervidus: Mfer_0571Help
Entry
Mfer_0571         CDS       T01351                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfv  Methanothermus fervidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfer_0571
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfer_0571
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfer_0571
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfer_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
556644..557963
Genome map
AA seq 439 aa AA seqDB search
MIGKLINFYSIDGDYMYKVLLDEKELPKKWYNITPDLPKQLSPPKGDRVKDLPKIFSKHV
LKQETSTKRWIKIPKKIREIYREIGRPTPLFRARNLEKMLNTPAKIYYKREDLSPTGSHK
LNTAIAQAYYAKKDGAEYLTTETGAGQWGSALSLACSLMDIGCKVFMVRVSYHQKPLRKI
LMQIYGAEVFPSPSKETEFGRKMLKKDPKHPGSLGIAISEAIEVALKNDNVYYSLGSVLN
HVLLHQTIIGLELKKQLEKIDEKPDIIVGCAGGGSNFSGAIFPFVKEKLNERLDCKFIAV
EPTACPTLTQGEYRYDYGDTAGMTPLIKMYTLGHDFVPPPVHAGGLRYHGMAPQLSLLVK
EKIVEARAVKQKDIFKSGILFSKAEGIVPAPETCHAIKVAIDEAKKCKKSGEEKTIVINF
SGHGLLDLKGYEKYLSTEE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgattggtaagttaataaatttttactcaattgacggtgattatatgtataaagtattg
ttagatgaaaaagaattaccaaaaaagtggtataatattacgccagaccttcctaaacaa
ctgtcaccaccaaaaggagatagagtaaaggatttaccaaagattttttctaagcatgta
ttaaaacaagaaacatctaccaaaagatggataaaaattcctaagaaaattagagaaatt
tatagagagattgggaggccaactcctttatttagagcccgtaatttagaaaaaatgcta
aacacgcccgcaaaaatatattataaaagggaagatctttctccgaccggtagtcataaa
ttaaacactgcaatagctcaagcatattatgcaaaaaaagacggggcagaatatttaaca
actgaaactggggcaggacaatggggctcagcactttcccttgcatgttcccttatggat
attggatgtaaagtttttatggtacgggtttcttaccaccaaaaaccattaagaaaaata
ttgatgcagatttatggcgctgaagttttcccttcacctagtaaggaaactgaatttggt
aggaaaatgttaaaaaaagatcctaaacatcctggatcattaggaattgcaatttcagag
gcaattgaagttgcattgaaaaatgacaatgtatattattctcttggaagtgtattaaat
catgtgcttctccatcaaacaataatcggattagaattgaaaaaacaattggaaaaaata
gatgaaaaaccagatattattgtgggatgtgctggcggaggtagtaatttttcaggtgca
atttttccttttgtaaaggaaaaattaaatgaaaggttagattgtaaatttatagctgtt
gaaccaacagcatgccccactttaactcaaggagaatatcgttatgattatggtgatact
gctggcatgactcctctaattaaaatgtatacattaggacatgattttgtaccacctcct
gtacatgcaggaggtcttaggtatcatggaatggcaccacaattatctttacttgtaaaa
gaaaaaatagtggaagctagggctgtaaaacagaaagatatttttaaaagtggaatatta
ttttctaaagcagaagggattgtaccagcgcctgaaacttgtcatgcaataaaggtagca
attgatgaagcaaaaaaatgcaaaaaaagtggtgaagaaaaaacaatcgttataaacttt
tcaggccacggattattagatttaaaaggatatgaaaaatatttaagcacagaagaataa

DBGET integrated database retrieval system