KEGG   Methanothermus fervidus: Mfer_0571Help
Entry
Mfer_0571         CDS       T01351                                 

Definition
pyridoxal-phosphate dependent trpb-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfv  Methanothermus fervidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfer_0571
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfer_0571
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfer_0571
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfer_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556644..557963
Genome map
AA seq 439 aa AA seqDB search
MIGKLINFYSIDGDYMYKVLLDEKELPKKWYNITPDLPKQLSPPKGDRVKDLPKIFSKHV
LKQETSTKRWIKIPKKIREIYREIGRPTPLFRARNLEKMLNTPAKIYYKREDLSPTGSHK
LNTAIAQAYYAKKDGAEYLTTETGAGQWGSALSLACSLMDIGCKVFMVRVSYHQKPLRKI
LMQIYGAEVFPSPSKETEFGRKMLKKDPKHPGSLGIAISEAIEVALKNDNVYYSLGSVLN
HVLLHQTIIGLELKKQLEKIDEKPDIIVGCAGGGSNFSGAIFPFVKEKLNERLDCKFIAV
EPTACPTLTQGEYRYDYGDTAGMTPLIKMYTLGHDFVPPPVHAGGLRYHGMAPQLSLLVK
EKIVEARAVKQKDIFKSGILFSKAEGIVPAPETCHAIKVAIDEAKKCKKSGEEKTIVINF
SGHGLLDLKGYEKYLSTEE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttgattggtaagttaataaatttttactcaattgacggtgattatatgtataaagtattg
ttagatgaaaaagaattaccaaaaaagtggtataatattacgccagaccttcctaaacaa
ctgtcaccaccaaaaggagatagagtaaaggatttaccaaagattttttctaagcatgta
ttaaaacaagaaacatctaccaaaagatggataaaaattcctaagaaaattagagaaatt
tatagagagattgggaggccaactcctttatttagagcccgtaatttagaaaaaatgcta
aacacgcccgcaaaaatatattataaaagggaagatctttctccgaccggtagtcataaa
ttaaacactgcaatagctcaagcatattatgcaaaaaaagacggggcagaatatttaaca
actgaaactggggcaggacaatggggctcagcactttcccttgcatgttcccttatggat
attggatgtaaagtttttatggtacgggtttcttaccaccaaaaaccattaagaaaaata
ttgatgcagatttatggcgctgaagttttcccttcacctagtaaggaaactgaatttggt
aggaaaatgttaaaaaaagatcctaaacatcctggatcattaggaattgcaatttcagag
gcaattgaagttgcattgaaaaatgacaatgtatattattctcttggaagtgtattaaat
catgtgcttctccatcaaacaataatcggattagaattgaaaaaacaattggaaaaaata
gatgaaaaaccagatattattgtgggatgtgctggcggaggtagtaatttttcaggtgca
atttttccttttgtaaaggaaaaattaaatgaaaggttagattgtaaatttatagctgtt
gaaccaacagcatgccccactttaactcaaggagaatatcgttatgattatggtgatact
gctggcatgactcctctaattaaaatgtatacattaggacatgattttgtaccacctcct
gtacatgcaggaggtcttaggtatcatggaatggcaccacaattatctttacttgtaaaa
gaaaaaatagtggaagctagggctgtaaaacagaaagatatttttaaaagtggaatatta
ttttctaaagcagaagggattgtaccagcgcctgaaacttgtcatgcaataaaggtagca
attgatgaagcaaaaaaatgcaaaaaaagtggtgaagaaaaaacaatcgttataaacttt
tcaggccacggattattagatttaaaaggatatgaaaaatatttaagcacagaagaataa

DBGET integrated database retrieval system