KEGG   Methanothermus fervidus: Mfer_0590Help
Entry
Mfer_0590         CDS       T01351                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mfv  Methanothermus fervidus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mfv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571765..573057
Genome map
AA seq 430 aa AA seqDB search
MEVVVFKKEKIENLIKRSEIDISTVIPKVSEIIREVKECGDEALINLTRKFDGVEIDKIK
VTKDEIKRSYKRLDDSIIHALKKASKNIKKFHERQIPKEWFINNDIYAGQIIRPIESVGC
YIPGGRAVYPSTALMTIIPAKVAGVKRVVCCTPPQENGFVDDATLVAADIAGADEIYKVG
GVQAIAALAYGTETIRPVNKIVGPGNIFVTAAKKLVYGDVDIDFLAGPSEVLIIADENAK
EEYITAEMLAQAEHDPQASSVLVTNSTKIANNVRSLIKKKIKKYKRREIIEKSLKENGKI
VITKNIRESIDFANKYAPEHLVLMVKNPEKYLKYINNAGSIFLGDNTPVSAGDYGLGSNH
VLPTGGFAKACGGLSTESFIKKITVQKLSKKGLLSLKDIVIPLSEYEGLDGHAKSFKKRL
EVLKSEHDKC
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgttgtgtttaaaaaagaaaaaatagagaatttaataaaaagatctgaaatt
gatataagcactgttataccgaaagttagtgaaataataagggaagtaaaagaatgtggg
gatgaagcactaataaatttaactcgaaagtttgatggagtagaaattgataaaattaaa
gttacaaaagatgaaataaaaagaagttacaaacgattagatgatagcattattcatgca
ttaaaaaaagcttcaaaaaatattaaaaaatttcatgaacgacaaattccaaaagaatgg
tttataaataatgatatttatgctggacaaataattagaccaattgaaagtgtagggtgt
tacataccaggaggtagagctgtatatccatctacagcattgatgacaataattcctgcg
aaagttgcaggagtaaaaagagttgtatgttgtacacctccacaagaaaatggatttgtt
gatgatgcaactttagttgctgcagatattgcaggagcagacgaaatatataaagtgggt
ggagtccaagcgatagctgcactagcttatggtactgaaacaataaggcctgtcaataaa
attgttggaccaggaaacatatttgtcactgctgcaaaaaaacttgtttatggagatgta
gacatagattttcttgctggaccttcagaggttttaataattgctgatgaaaatgctaaa
gaagaatacattactgctgaaatgttggcacaagcagaacatgatccacaagcttcatca
gttcttgttaccaattcaacgaaaattgcaaacaacgttagatccctgattaaaaagaaa
attaaaaaatataaaagaagagaaattattgaaaaatcattaaaagaaaatggtaaaatt
gtaataactaaaaacattagagaatctattgactttgctaacaaatatgcgcctgaacat
ctagtattaatggttaaaaatccagaaaaatatttaaaatatataaacaatgcaggttca
atatttttgggtgataatacaccagtatcagctggagattatggattaggaagtaatcat
gttttaccaactggaggatttgcaaaagcatgtggaggtctatctacagaatcatttatt
aaaaaaataactgtgcaaaaactttctaaaaaaggactactttccctaaaagatatcgta
attccactttcagaatatgaaggtttggacggacatgcaaaatctttcaagaaaagacta
gaggtgttaaaaagtgagcatgataaatgttaa

DBGET integrated database retrieval system