KEGG   Methanothermus fervidus: Mfer_0620Help
Entry
Mfer_0620         CDS       T01351                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00250  Alanine, aspartate and glutamate metabolism
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mfer_0620
Enzymes [BR:mfv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mfer_0620
Peptidases [BR:mfv01002]
 Cysteine Peptidases
  Family C44
   Mfer_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ADP77419
UniProt: E3GYN7
Position
601833..603248
Genome map
AA seq 471 aa AA seqDB search
MCGIAGFSGKNAKKIVEKMLKILRHRGPDATGIYYDSKVKIIYDKKVEEKEAPPSSNLAL
GHNLLSIIGGPQPITGKGVLVFNGEIYNYKELYAKANSDAETVLYLIEKHGGDIEDALKW
TVNKIDGDYAFAYFDGENIALVRDPVGVKPLYYSDSAFASERKALWKIGLKDIKSLKPGH
ALINNKLVKLKDLPKPKPLNNIKLEKLKNMLKSSIISAVEKRTRDIDKAALVFSGGVDST
LLAILLDKYIDVKLYTVGVPGSQDLKFALKAAKDLDMELKVLKIEKDVVKEMLPKVLTAI
EEYNIMKIGVAMPLYIASAAASSDGYKVIFSGQGADELFAGYYRYKRLLREGKLEEALLH
DLKNMYHVNLERDDAATMANSIELRVPFLDYDVIKVAVQIPIKYKIKDPSDILRKRILRE
IAIELGVPEYIAMRPKKAVQYGSGVDKILRKKVLPNFDHESFMKKLMSASG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattgcaggtttttctggaaaaaatgcaaaaaaaattgttgaaaaaatgctt
aaaattttaaggcatcgaggacctgatgcaacaggaatttattatgatagcaaagtaaaa
attatttatgataaaaaagtggaggagaaagaagctccgccttccagcaatttagccctt
ggtcataatcttctttcaataattggaggtccccagccaatcacaggaaaaggtgtctta
gtgtttaatggtgaaatttataattacaaagaactttatgctaaggcaaattcagatgca
gaaacagtactttaccttattgagaaacatggtggagatattgaagatgctctcaaatgg
actgttaacaaaatagatggagattatgcatttgcttattttgatggtgaaaatatcgca
ttagtacgtgatccagtaggtgttaaaccactttattactctgattcagcatttgcttca
gaaagaaaagctttatggaaaataggcttgaaagatataaaaagtcttaaaccaggacat
gctctcataaataataagcttgtaaaacttaaagatcttccaaaaccaaaacctcttaat
aatattaaactagaaaaattgaaaaatatgcttaagtcatccattatttctgcagttgaa
aaaagaactagagacatcgataaggcagcattagtattttctggtggtgttgacagtaca
ttactagcaattcttcttgataaatatattgatgttaaactttatactgtaggagttcca
ggttcccaagatcttaaattcgcattaaaagctgcaaaagatttagatatggaacttaaa
gttttaaaaattgaaaaagatgttgtaaaagaaatgctcccaaaagtacttacagctatc
gaggaatataatataatgaaaattggagtggcaatgcctctctacattgcatctgcagct
gcatcatctgatggatataaagtcatattttctggccaaggagctgatgaattatttgca
ggatattatcgttacaaacggcttttaagagaaggaaaacttgaggaagcacttctccat
gacttgaaaaacatgtatcatgtaaaccttgagagagatgatgctgctacaatggcaaac
tcaattgaacttcgtgtacctttccttgattatgatgtgataaaagttgcagttcaaata
cctataaaatataaaataaaggatccaagcgatatccttaggaaaagaatattacgggaa
attgctattgaacttggagtgcccgaatacatagcaatgagaccaaagaaggcagtccaa
tatggttcaggtgtagataaaatattaaggaaaaaagtactcccaaattttgaccatgaa
tctttcatgaaaaaattaatgagtgcttcaggataa

DBGET integrated database retrieval system