KEGG   Methanothermus fervidus: Mfer_0689Help
Entry
Mfer_0689         CDS       T01351                                 

Definition
histone acetyltransferase, elp3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mfv  Methanothermus fervidus
Brite
Enzymes [BR:mfv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mfer_0689
Transfer RNA biogenesis [BR:mfv03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mfer_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667492..669087
Genome map
AA seq 531 aa AA seqDB search
MMIKKACRYIIKQVKEGKVKNKDELEIVKRKACKKFGIKKFVSNSEILKYATQEEKEIIA
PIIRKKPVRTISGVAVVAVMCHPTPCPHGKCLYCPQSTKAPPSYTGEEPAALRARRHKYD
PYRQVKDRLDQLKSIGHPIDKVELIIMGGTFPAHDLCYQEWFVSRCLQAMNEFGSKKEKK
EFQYLEDIQKINEKSKVRCVGMTVETRPDYSKEEDVDRMLSFGVTRVELGVQTIYNYIYH
RVKRGHDIKDVIEANRILRDSGLKVGMHIMPGLFADEEKDLRIFKRLFSDPSFRPDMLKI
YPCLVTKESELYELWKRGEYRPYNTEEAVELIVKIKKLLPKWVRTMRIQRDIPSPLIVDG
VKKSNLGELVYRKLKEEGVRCKCIRCREIGHRMKEGVMPEEDNIKIFKEEYKAADGKEIF
ISHEDKENDVLVGFLRLRIPSKKAHRKEIDENTAIVRELHVYGPMVPIGKKSKMIGQHRG
YGEELLKFAENIALKRGKNKIVITSGIGVRDYYRNFGYKREGPYMAKILDQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgataaagaaagcatgtcgctacataataaagcaagtaaaggaaggaaaagttaaa
aataaagatgaattggaaattgttaagcgtaaagcatgcaaaaaatttggcataaaaaaa
tttgttagcaattctgaaattttaaaatatgctacccaagaagagaaagaaataattgct
cccatcatacgtaagaaaccagttaggacaatatccggtgttgcagttgtagcagtaatg
tgtcacccaacaccttgcccacatggaaaatgcctatactgtccacaaagtactaaagct
ccaccaagttatactggagaagaacctgctgctctcagggcacgtagacataagtatgat
ccatatagacaagtcaaagatagattagatcaattaaagagcataggacatccgattgat
aaagtagaattaataattatgggtggaacctttccagcccatgatttatgttatcaagag
tggtttgtatcacggtgtttacaagcaatgaatgaatttggatctaaaaaagagaaaaaa
gaatttcaatatttagaagacattcaaaaaattaatgaaaaatcaaaggttagatgtgta
ggaatgactgttgaaactagaccagattactccaaagaggaagatgtagacagaatgttg
tcatttggggtaactagggtagaattgggagtacagacaatatacaattatatatatcat
agagttaaaagaggacatgacattaaagatgttatagaagcaaataggattttaagagat
tctggattaaaagtgggaatgcatataatgcctgggttatttgcagatgaagaaaaagat
ttaagaatatttaaaagattattttctgatccttcttttagaccagatatgttgaagata
tatccatgtttagtaacaaaagaaagtgaattatatgagttatggaagagaggagagtat
agaccatataatacagaagaagctgtcgaattgattgtaaaaataaaaaaattactacca
aaatgggttagaacgatgcgaatacaacgtgacataccttcaccattaattgtagacggt
gttaaaaaatcaaatttaggagagttagtttacagaaaattaaaagaagaaggtgtcaga
tgcaaatgtattagatgtcgtgaaataggtcatagaatgaaggaaggtgtcatgccagag
gaggacaatataaaaattttcaaagaagaatataaagctgcagatggcaaagaaatattt
atttctcatgaggataaagaaaatgacgtattagttggatttttacgtttaagaattcct
tccaaaaaagcccatcggaaggaaatagatgaaaacacggctatagtccgtgaattgcat
gtttatggacctatggtccctattggtaaaaaatcgaaaatgattggacaacatagaggt
tatggagaagaattacttaaatttgctgaaaatatagcattaaaacgtggaaaaaacaaa
atagttatcactagtggtataggtgttcgagattattatcgaaattttggttataaacgt
gaaggtccttacatggcaaagattcttgatcagtaa

DBGET integrated database retrieval system