KEGG   Methanothermus fervidus: Mfer_0749Help
Entry
Mfer_0749         CDS       T01351                                 

Definition
fructose-bisphosphate aldolase ;d-fructose 1,6-bisphosphatase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mfv  Methanothermus fervidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0749
   01230 Biosynthesis of amino acids
    Mfer_0749
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0749
   00030 Pentose phosphate pathway
    Mfer_0749
   00051 Fructose and mannose metabolism
    Mfer_0749
  Energy metabolism
   00680 Methane metabolism
    Mfer_0749
Enzymes [BR:mfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mfer_0749
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mfer_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726009..727109
Genome map
AA seq 366 aa AA seqDB search
MKTTISVIKADIGSVAGHVVAHKALKDKCREVLSKAKEDGIIEDFYVTNCGDDVNLIMTH
RRGEDDEEVHRTAWEAFKEATKVSKKMKLYGAGQDLLSDTFSGNVKGLGPGCAEMEFKER
PSDPVVVFCCDKTEPGAFNLPLFRIFADPFNTAGLVIDPSLHKGYKFEVYDVIDHKRVMM
SCPEEMYDLLALLGSISRYVIKKIYRKKDDEIAASVSTERLNLIAGKYIGKDDPVAIVRA
QSGFPATGEILEAFAQPHLVGGWMRGSHNGPLMPVSEKDAVPTRFDGPPRVMALGFQISE
CKLIGPIDLFDDPIFERSRRLAANISEYMRRHGPFEPHRLPSDEMEYTTLPDVLKKLKDR
FEDIED
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactattagtgttataaaggcagatattggaagtgtagctggacatgttgtt
gcacataaagcccttaaagacaaatgtagagaagtactgtcaaaggcaaaggaagatgga
attatagaggacttttatgtcacaaattgtggtgacgatgtaaaccttataatgacacat
agaagaggagaagatgatgaagaggtgcataggactgcatgggaagcattcaaggaagca
actaaagtttctaaaaagatgaaattatatggtgctggacaagatttactatctgacact
ttttcaggtaatgtaaagggtttaggacctggatgtgcagaaatggagtttaaagaaaga
cctagtgaccctgtagttgtgttttgttgtgataaaacagagccaggagcatttaattta
ccactcttcagaatatttgctgatccatttaacacagctggtttagttattgatccttct
ctacacaaaggatataaatttgaggtatatgatgtgatagaccacaaaagagtgatgatg
tcatgtccagaagagatgtatgatttacttgctcttttaggatcaattagtagatatgtg
ataaagaaaatctacaggaagaaagatgatgaaatagctgcctcagtaagcactgaaaga
ttaaacttaatagcagggaaatacataggaaaagatgaccctgtggcaatagttagggca
caatcaggatttccagcaactggtgaaatattagaagcgtttgcccaaccacatctagtt
ggaggatggatgagaggatcacataatggtcctttaatgccagtatctgaaaaagatgca
gttccaacaagatttgatggaccaccacgtgttatggcattaggtttccaaatatctgaa
tgtaaattaataggacctatcgatttgtttgatgaccctatctttgagcgttcaaggaga
ttagcagcaaatatatctgaatatatgaggcgtcatgggccatttgagccacataggtta
cctagtgatgagatggaatatacaactttaccagatgtacttaaaaaattgaaagataga
tttgaggacatagaggattaa

DBGET integrated database retrieval system