KEGG   Methanothermus fervidus: Mfer_0749Help
Entry
Mfer_0749         CDS       T01351                                 

Definition
(GenBank) fructose-bisphosphate aldolase; D-fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mfv  Methanothermus fervidus
Pathway
mfv00010  Glycolysis / Gluconeogenesis
mfv00030  Pentose phosphate pathway
mfv00051  Fructose and mannose metabolism
mfv00680  Methane metabolism
mfv01100  Metabolic pathways
mfv01110  Biosynthesis of secondary metabolites
mfv01120  Microbial metabolism in diverse environments
mfv01130  Biosynthesis of antibiotics
mfv01200  Carbon metabolism
mfv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfer_0749
   00030 Pentose phosphate pathway
    Mfer_0749
   00051 Fructose and mannose metabolism
    Mfer_0749
  Energy metabolism
   00680 Methane metabolism
    Mfer_0749
Enzymes [BR:mfv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mfer_0749
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mfer_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ADP77548
UniProt: E3GZ16
Position
726009..727109
Genome map
AA seq 366 aa AA seqDB search
MKTTISVIKADIGSVAGHVVAHKALKDKCREVLSKAKEDGIIEDFYVTNCGDDVNLIMTH
RRGEDDEEVHRTAWEAFKEATKVSKKMKLYGAGQDLLSDTFSGNVKGLGPGCAEMEFKER
PSDPVVVFCCDKTEPGAFNLPLFRIFADPFNTAGLVIDPSLHKGYKFEVYDVIDHKRVMM
SCPEEMYDLLALLGSISRYVIKKIYRKKDDEIAASVSTERLNLIAGKYIGKDDPVAIVRA
QSGFPATGEILEAFAQPHLVGGWMRGSHNGPLMPVSEKDAVPTRFDGPPRVMALGFQISE
CKLIGPIDLFDDPIFERSRRLAANISEYMRRHGPFEPHRLPSDEMEYTTLPDVLKKLKDR
FEDIED
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactattagtgttataaaggcagatattggaagtgtagctggacatgttgtt
gcacataaagcccttaaagacaaatgtagagaagtactgtcaaaggcaaaggaagatgga
attatagaggacttttatgtcacaaattgtggtgacgatgtaaaccttataatgacacat
agaagaggagaagatgatgaagaggtgcataggactgcatgggaagcattcaaggaagca
actaaagtttctaaaaagatgaaattatatggtgctggacaagatttactatctgacact
ttttcaggtaatgtaaagggtttaggacctggatgtgcagaaatggagtttaaagaaaga
cctagtgaccctgtagttgtgttttgttgtgataaaacagagccaggagcatttaattta
ccactcttcagaatatttgctgatccatttaacacagctggtttagttattgatccttct
ctacacaaaggatataaatttgaggtatatgatgtgatagaccacaaaagagtgatgatg
tcatgtccagaagagatgtatgatttacttgctcttttaggatcaattagtagatatgtg
ataaagaaaatctacaggaagaaagatgatgaaatagctgcctcagtaagcactgaaaga
ttaaacttaatagcagggaaatacataggaaaagatgaccctgtggcaatagttagggca
caatcaggatttccagcaactggtgaaatattagaagcgtttgcccaaccacatctagtt
ggaggatggatgagaggatcacataatggtcctttaatgccagtatctgaaaaagatgca
gttccaacaagatttgatggaccaccacgtgttatggcattaggtttccaaatatctgaa
tgtaaattaataggacctatcgatttgtttgatgaccctatctttgagcgttcaaggaga
ttagcagcaaatatatctgaatatatgaggcgtcatgggccatttgagccacataggtta
cctagtgatgagatggaatatacaactttaccagatgtacttaaaaaattgaaagataga
tttgaggacatagaggattaa

DBGET integrated database retrieval system