KEGG   Methanothermus fervidus: Mfer_0762Help
Entry
Mfer_0762         CDS       T01351                                 

Definition
mur ligase middle domain protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mfv  Methanothermus fervidus
Pathway
Lysine biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mfv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737854..739284
Genome map
AA seq 476 aa AA seqDB search
MRLSELASYVSGKLIGEDKEIKVGIFNTLGDANPNDIVIRHWIDEKGVEIAKNKEVSALI
TQNPKGNSLEYAKKLKVPIILVNKIELASAFAIKWTIKNFAPNTYRVVITGTNGKSTTTH
MIYHILTHAGKKAFTNTDAKSEFNTLIDPMVAKLLAEKAKKENLEYLVIEVSEVQGWLDR
LMKDHAYLMTKSINPNVVVVTNVALDHIGLVNSIEEVFEETSGAVKALEKGFAVLNYDNE
FTRKMAKLTNKNVKVFFYGKNCPVTFKSGGIYVNNDLFIKKEELPFKSEYFIQNTLAAIS
ACLCLNIPPDIIKKGILTYKPLKRRFSILCKKPLIIDDFAHNPDGIKMAIKSAKKLTKNK
LWVVCAIRGSRGKIINKLNAESLSKTLKNIENYEVVITNSDDVVDNLNKVKKEEEKTFLK
TLEKYNINYRFHKKLKTALEETLTNCKKDDTILLIGAQGMDPASKLLKKIKVIPCS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagattaagtgaattagcttcatatgtttctggaaaattaataggggaagataaggaa
ataaaagtgggtatatttaatactctaggcgatgctaatccaaatgatattgtgattaga
cattggatagatgaaaaaggtgtagaaattgcaaaaaataaagaagtatcagcacttata
actcaaaatccaaaaggaaattcattagaatatgcaaaaaagttgaaagtacctataatt
ttagttaacaagattgaacttgccagtgcatttgccataaaatggacaataaaaaatttt
gcaccaaacacttatagagttgtaatcacaggtactaatggtaagtcaacaacaacccat
atgatatatcatattttaacccatgctggaaagaaagcatttacaaacacagatgcaaag
tcagagtttaacactctgatagacccaatggtagctaagttacttgctgaaaaggctaaa
aaagaaaacctcgaatatttggtcattgaagtgtctgaagttcaaggatggctagatcgt
ctcatgaaagaccatgcatatctcatgacaaaatccataaatcctaatgtagttgtagtt
accaatgtagcattggaccatataggtttagttaattcaattgaagaagtgtttgaagaa
actagtggggctgtaaaagcattggaaaaaggatttgctgtacttaattatgataatgaa
tttacaagaaaaatggctaaactcacaaataaaaatgtaaaagtcttcttttatggaaaa
aattgtccagtaacttttaaaagtggtggaatttatgttaacaatgatttattcataaaa
aaagaagaacttccattcaaaagtgaatattttatacaaaatactcttgctgcaatatct
gcttgtttatgtttaaatattcctccagacattataaaaaaaggaattttaacatacaaa
ccactaaagagaagattttcaattttatgtaaaaaaccattaataatagatgattttgca
cataaccctgacggtatcaaaatggctataaagagtgcaaaaaaacttacaaaaaacaaa
ttgtgggttgtatgtgctatacgtgggtctagaggaaaaattatcaacaaattaaatgcg
gaatcgttatcaaagactttaaaaaacattgaaaattatgaagttgttataaccaatagt
gacgatgttgtggataaccttaataaagtaaaaaaagaagaagaaaaaacatttttaaaa
acactggagaagtataatataaattatagattccacaaaaaattgaaaactgctttggaa
gaaactttaactaattgtaaaaaagatgatacgatcttgttgataggtgctcaaggtatg
gatcctgcctcaaaactattaaaaaaaataaaagtgataccatgttcataa

DBGET integrated database retrieval system