KEGG   Methanothermus fervidus: Mfer_0813Help
Entry
Mfer_0813         CDS       T01351                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mfv  Methanothermus fervidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mfv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786932..787969)
Genome map
AA seq 345 aa AA seqDB search
MKKLIKKLTETPGISGFEEKIRELIKNEIEDYVDEVKYDSLGNLIAVKKGGDKKVMLAAH
MDEIGLMVKHINKKGFVKFSKIGGINDQMLLNQTVKIHGEKTVTGVIGSKPPHRMKPKER
KRVISYENMFIDIGVKNEKEAKKLISVGDPITFEGNFEMLSDKIFKAKALDNRLGCLVMI
EVLKKVDSSATIYGVGTVQEEVGLKGARTSAYQINPDLAIALDVTIAGDHPGIKKEDAPV
ELGKGPVIVLTDASGRGIITHPKVRKLLITTAEKENIEYQLEVSEGGTTDATAIHLTRAG
IPSGVLSVPTRYIHTPVSVAHLDDVKNCIKLLTKALEKYLEVIEN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgataaaaaaattaactgaaactcccggaatttctggatttgaagaaaag
ataagagaactcataaaaaatgaaatagaggattatgtagatgaagtaaaatatgattct
cttggaaatctcattgctgtaaaaaaaggaggagataaaaaagtaatgttagcagctcac
atggatgaaattggattaatggtcaagcatattaataaaaaaggttttgttaaattttct
aaaattggaggaataaacgatcaaatgttgttaaaccaaacagttaaaattcatggtgaa
aaaacagttacaggagttataggatctaaaccaccacatcgaatgaagcctaaagaaaga
aagagagttataagttatgaaaacatgttcatagacattggtgttaaaaatgaaaaagaa
gctaagaaattaatatctgtgggtgatcctataacctttgaaggaaattttgagatgtta
tctgataaaatttttaaagctaaagcattagacaatagacttggttgtttagtaatgatt
gaagttttaaagaaagttgatagttctgcaactatttatggcgttggaaccgttcaagaa
gaggtaggtcttaaaggtgcaagaacttctgcatatcagataaaccctgatttagctata
gcactagatgtaactatagcaggagatcatccaggaataaaaaaagaagatgcaccagtt
gaattaggtaaaggaccagttatagttttaacagatgcaagtggcagagggataataaca
catccaaaagttagaaaattattaataactactgctgagaaggaaaatatagaatatcag
ttagaagtaagtgaaggtggaactactgatgcaacagctatacatcttactagggctggt
ataccatcaggagttctctcagttccaacaagatatatccatactccagtaagtgttgca
catttagacgatgttaagaattgtataaaattattaactaaagctcttgagaaatattta
gaagttattgaaaattaa

DBGET integrated database retrieval system