KEGG   Methanothermus fervidus: Mfer_0813Help
Entry
Mfer_0813         CDS       T01351                                 

Definition
(GenBank) Cellulase
Organism
mfv  Methanothermus fervidus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 EnY2 DUF1476
Motif
Other DBs
NCBI-ProteinID: ADP77612
UniProt: E3GZ80
Position
complement(786932..787969)
Genome map
AA seq 345 aa AA seqDB search
MKKLIKKLTETPGISGFEEKIRELIKNEIEDYVDEVKYDSLGNLIAVKKGGDKKVMLAAH
MDEIGLMVKHINKKGFVKFSKIGGINDQMLLNQTVKIHGEKTVTGVIGSKPPHRMKPKER
KRVISYENMFIDIGVKNEKEAKKLISVGDPITFEGNFEMLSDKIFKAKALDNRLGCLVMI
EVLKKVDSSATIYGVGTVQEEVGLKGARTSAYQINPDLAIALDVTIAGDHPGIKKEDAPV
ELGKGPVIVLTDASGRGIITHPKVRKLLITTAEKENIEYQLEVSEGGTTDATAIHLTRAG
IPSGVLSVPTRYIHTPVSVAHLDDVKNCIKLLTKALEKYLEVIEN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgataaaaaaattaactgaaactcccggaatttctggatttgaagaaaag
ataagagaactcataaaaaatgaaatagaggattatgtagatgaagtaaaatatgattct
cttggaaatctcattgctgtaaaaaaaggaggagataaaaaagtaatgttagcagctcac
atggatgaaattggattaatggtcaagcatattaataaaaaaggttttgttaaattttct
aaaattggaggaataaacgatcaaatgttgttaaaccaaacagttaaaattcatggtgaa
aaaacagttacaggagttataggatctaaaccaccacatcgaatgaagcctaaagaaaga
aagagagttataagttatgaaaacatgttcatagacattggtgttaaaaatgaaaaagaa
gctaagaaattaatatctgtgggtgatcctataacctttgaaggaaattttgagatgtta
tctgataaaatttttaaagctaaagcattagacaatagacttggttgtttagtaatgatt
gaagttttaaagaaagttgatagttctgcaactatttatggcgttggaaccgttcaagaa
gaggtaggtcttaaaggtgcaagaacttctgcatatcagataaaccctgatttagctata
gcactagatgtaactatagcaggagatcatccaggaataaaaaaagaagatgcaccagtt
gaattaggtaaaggaccagttatagttttaacagatgcaagtggcagagggataataaca
catccaaaagttagaaaattattaataactactgctgagaaggaaaatatagaatatcag
ttagaagtaagtgaaggtggaactactgatgcaacagctatacatcttactagggctggt
ataccatcaggagttctctcagttccaacaagatatatccatactccagtaagtgttgca
catttagacgatgttaagaattgtataaaattattaactaaagctcttgagaaatattta
gaagttattgaaaattaa

DBGET integrated database retrieval system