KEGG   Methanothermus fervidus: Mfer_0935Help
Entry
Mfer_0935         CDS       T01351                                 

Definition
class ii aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mfv  Methanothermus fervidus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mfer_0935
Enzymes [BR:mfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mfer_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886417..886965
Genome map
AA seq 182 aa AA seqDB search
MKKIVKYAHYLHRKGFTAGNAGNISVLYRNKIMDVVAITSSGSCLGTISEDEIVLLDLDG
NVISGKKPSSELHLHMNLYKIRDDINAIVHTHPPYTVALTMKDIRIERPEGVPGNKKFLE
EIPYYRPGSIELANACSKKLKKEKILVLKKHGLVTCGSSLEEAVNLTELVENAAKITYIS
SQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgtaaagtatgcacactatttacataggaagggttttactgctggcaat
gctggaaacataagtgtcttatatagaaataaaattatggatgttgttgccattacatct
agtggttcatgcttaggaacaattagtgaagatgaaattgtattgttagatcttgatggg
aatgtgatatctggcaaaaaaccttcatctgaactacatttacatatgaacctttataaa
ataagggatgatataaatgctatagttcatactcatcctccttatacagtagcactaaca
atgaaagatattagaatcgaaagaccagaaggtgttcctggaaataaaaaatttttagaa
gaaattccatattatagacctgggagtattgagttggcaaatgcatgttcaaaaaaatta
aaaaaagaaaaaattttagtattgaagaagcatggtttagttacatgcggatcttcacta
gaagaagctgtgaatttaacagaattagtagaaaatgcggctaaaataacttatatatca
tctcaatag

DBGET integrated database retrieval system