KEGG   Methanothermus fervidus: Mfer_0975Help
Entry
Mfer_0975         CDS       T01351                                 

Definition
(GenBank) formylmethanofuran dehydrogenase, subunit H
  KO
K00204  4Fe-4S ferredoxin
Organism
mfv  Methanothermus fervidus
Pathway
mfv00680  Methane metabolism
mfv01100  Metabolic pathways
mfv01120  Microbial metabolism in diverse environments
mfv01200  Carbon metabolism
Module
mfv_M00567  Methanogenesis, CO2 => methane
mfv_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mfer_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 HTH_3 Fer4_7 Fer4_9 HTH_23 Fer4_6 Fer4_17 HTH_38 Fer4_16 Fer4_2 Fer4_10 HTH_19 HTH_37 UPF0175 HTH_31 HTH_28 Sigma70_r4_2 HTH_24 HTH_IclR HTH_29 HTH_5 Fer4_22 HTH_26 HTH_35 HTH_7 HTH_40 HNF-1_N HTH_psq RepB HTH_Tnp_4 Sigma70_r4 HTH_8 Fer4_3 TnsD Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ADP77771
UniProt: E3GW06
Position
929155..929619
Genome map
AA seq 154 aa AA seqDB search
MPSHLASALKCITAIKLKKQGLSQAKISKLLGINRSTVSHYLHGRNVSPKSLKVAKIIIN
FCPRDFILFVQSVIEKKEEVKTIVKTCQNRNFKVLVKDSCIGCGTCSEKCPMDAIKISGL
KAKVNSKLCCGCEFCIKVCKTNSIEIMEVKNNGN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacatttagcctcagccctgaagtgtataaccgcaataaaactcaaaaaacaa
ggattatcacaagctaaaatatctaaattgcttggtataaatagatcaacggtttctcat
tatttacacggcagaaatgtctctccaaaatcactaaaggtagcaaaaataataatcaat
ttttgtccaagagatttcatactttttgtacagagtgttatagaaaaaaaagaagaagta
aaaacaatagtaaagacatgtcaaaatagaaacttcaaagttcttgtaaaagattcttgt
attggatgcggaacatgtagtgaaaaatgtcctatggatgccataaaaatttcagggctg
aaggctaaagtaaattctaaattatgttgcggatgtgaattttgtattaaagtttgtaaa
acaaattcaattgaaattatggaggtaaaaaacaatggaaattga

DBGET integrated database retrieval system