KEGG   Methanothermus fervidus: Mfer_0975Help
Entry
Mfer_0975         CDS       T01351                                 

Definition
formylmethanofuran dehydrogenase, subunit h (EC:1.2.99.5)
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mfv  Methanothermus fervidus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfer_0975
  Energy metabolism
   00680 Methane metabolism
    Mfer_0975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929155..929619
Genome map
AA seq 154 aa AA seqDB search
MPSHLASALKCITAIKLKKQGLSQAKISKLLGINRSTVSHYLHGRNVSPKSLKVAKIIIN
FCPRDFILFVQSVIEKKEEVKTIVKTCQNRNFKVLVKDSCIGCGTCSEKCPMDAIKISGL
KAKVNSKLCCGCEFCIKVCKTNSIEIMEVKNNGN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacatttagcctcagccctgaagtgtataaccgcaataaaactcaaaaaacaa
ggattatcacaagctaaaatatctaaattgcttggtataaatagatcaacggtttctcat
tatttacacggcagaaatgtctctccaaaatcactaaaggtagcaaaaataataatcaat
ttttgtccaagagatttcatactttttgtacagagtgttatagaaaaaaaagaagaagta
aaaacaatagtaaagacatgtcaaaatagaaacttcaaagttcttgtaaaagattcttgt
attggatgcggaacatgtagtgaaaaatgtcctatggatgccataaaaatttcagggctg
aaggctaaagtaaattctaaattatgttgcggatgtgaattttgtattaaagtttgtaaa
acaaattcaattgaaattatggaggtaaaaaacaatggaaattga

DBGET integrated database retrieval system