KEGG   Methanothermus fervidus: Mfer_1198Help
Entry
Mfer_1198         CDS       T01351                                 

Definition
l-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mfv01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mfv00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mfv00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145106..1146299
Genome map
AA seq 397 aa AA seqDB search
MIMRCVVCGKEYPADEIIYTCNECGSVLEVLMETEVSKKIFEGRKWNMWRYKEFLPVDES
KKVSLNEGGTPFIKCNNLSKDLKVDLYVKVEGSNPTGSFKDRGMSVGVTKALEFNVDTVG
CASTGNTSASLAAYAARAGLRCIVFLPAGKVALGKLAQAMFHGAQVLSIKDNFDKALEIV
TKFALGGYLYLLNSVNPFRLEGQKTIAFEILEELNWESPDHIILPVGNAGNISAIWKGIK
EFYESDFIDEKPCMIGIQAEGASPIVEAVKKQKLDIKPVKNPETVATAIRIGSPVNYPKA
LRAIYESNGTALSVSDEEILKAQRLLAKKEGIGVEPASAASIAGLIKLIDDGYLDHGERV
VCVLTGHLLKDPKIAINACKKPLEVEPDFNLLKKIIG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattatgagatgtgtagtatgcggaaaagaataccctgcagatgaaatcatatacact
tgtaatgaatgcgggtcagtactagaagtcttgatggaaacagaggtatcaaagaaaata
tttgaaggcagaaagtggaatatgtggagatacaaagaatttttacctgtagatgaatct
aaaaaagtatcacttaatgaaggaggtactccatttataaaatgtaataatttgtcaaaa
gatcttaaagttgatttatatgttaaggtagagggttcaaacccaacaggtagttttaaa
gatagaggtatgagtgtaggagttacaaaagctcttgaatttaatgttgacacagttgga
tgtgcctcaactggtaatacttccgcatctttagctgcatatgcagcaagagctggtctt
agatgtatagtatttttaccagcagggaaagttgctttgggaaaattagctcaagccatg
tttcatggagcccaggtgttatcaattaaggataattttgataaggcattagagattgtc
acaaagtttgctcttggtggatatttatatctactaaattctgtaaatccttttagatta
gaaggacaaaagacaatcgcatttgaaatattggaagaactgaattgggaatctccagac
cacatcatcttacctgttggaaatgcaggaaacatttcagcgatatggaaaggaataaag
gaattttatgaatctgatttcatagatgagaaaccatgcatgattggaatacaggctgaa
ggagcttcaccaatagttgaagctgtaaagaaacaaaaacttgatataaagcctgtaaaa
aatcctgaaacagttgcaacagctataaggataggttctccagttaattatcctaaagct
ttgagagcaatatatgaatccaatggaactgccctaagcgtcagtgatgaagaaatactt
aaggctcaaagactattagcaaaaaaagaaggtataggtgttgagccagcatcagctgca
agtattgcaggactaatcaaattaatagatgatggctatttagatcatggagaaagagtt
gtatgcgtattgacagggcatcttctaaaagatccaaaaattgctataaatgcttgtaaa
aagcctttagaagtagaaccagattttaatttactaaaaaagattattggataa

DBGET integrated database retrieval system