KEGG   Methanothermus fervidus: Mfer_1198Help
Entry
Mfer_1198         CDS       T01351                                 

Definition
(RefSeq) l-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfv  Methanothermus fervidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfer_1198
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfer_1198
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mfer_1198
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mfer_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145106..1146299
Genome map
AA seq 397 aa AA seqDB search
MIMRCVVCGKEYPADEIIYTCNECGSVLEVLMETEVSKKIFEGRKWNMWRYKEFLPVDES
KKVSLNEGGTPFIKCNNLSKDLKVDLYVKVEGSNPTGSFKDRGMSVGVTKALEFNVDTVG
CASTGNTSASLAAYAARAGLRCIVFLPAGKVALGKLAQAMFHGAQVLSIKDNFDKALEIV
TKFALGGYLYLLNSVNPFRLEGQKTIAFEILEELNWESPDHIILPVGNAGNISAIWKGIK
EFYESDFIDEKPCMIGIQAEGASPIVEAVKKQKLDIKPVKNPETVATAIRIGSPVNYPKA
LRAIYESNGTALSVSDEEILKAQRLLAKKEGIGVEPASAASIAGLIKLIDDGYLDHGERV
VCVLTGHLLKDPKIAINACKKPLEVEPDFNLLKKIIG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattatgagatgtgtagtatgcggaaaagaataccctgcagatgaaatcatatacact
tgtaatgaatgcgggtcagtactagaagtcttgatggaaacagaggtatcaaagaaaata
tttgaaggcagaaagtggaatatgtggagatacaaagaatttttacctgtagatgaatct
aaaaaagtatcacttaatgaaggaggtactccatttataaaatgtaataatttgtcaaaa
gatcttaaagttgatttatatgttaaggtagagggttcaaacccaacaggtagttttaaa
gatagaggtatgagtgtaggagttacaaaagctcttgaatttaatgttgacacagttgga
tgtgcctcaactggtaatacttccgcatctttagctgcatatgcagcaagagctggtctt
agatgtatagtatttttaccagcagggaaagttgctttgggaaaattagctcaagccatg
tttcatggagcccaggtgttatcaattaaggataattttgataaggcattagagattgtc
acaaagtttgctcttggtggatatttatatctactaaattctgtaaatccttttagatta
gaaggacaaaagacaatcgcatttgaaatattggaagaactgaattgggaatctccagac
cacatcatcttacctgttggaaatgcaggaaacatttcagcgatatggaaaggaataaag
gaattttatgaatctgatttcatagatgagaaaccatgcatgattggaatacaggctgaa
ggagcttcaccaatagttgaagctgtaaagaaacaaaaacttgatataaagcctgtaaaa
aatcctgaaacagttgcaacagctataaggataggttctccagttaattatcctaaagct
ttgagagcaatatatgaatccaatggaactgccctaagcgtcagtgatgaagaaatactt
aaggctcaaagactattagcaaaaaaagaaggtataggtgttgagccagcatcagctgca
agtattgcaggactaatcaaattaatagatgatggctatttagatcatggagaaagagtt
gtatgcgtattgacagggcatcttctaaaagatccaaaaattgctataaatgcttgtaaa
aagcctttagaagtagaaccagattttaatttactaaaaaagattattggataa

DBGET integrated database retrieval system