KEGG   Methanothermus fervidus: Mfer_1200Help
Entry
Mfer_1200         CDS       T01351                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mfv  Methanothermus fervidus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mfer_1200
Enzymes [BR:mfv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mfer_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1146733..1147590)
Genome map
AA seq 285 aa AA seqDB search
MGLKFAYSKDPSSLKYLSNKKVFGLLGVPFDSTSTYKPGSRFGPLMIRQASYNFENYSLH
YRKKLDVPIIDLGDIEVILGDFKNTCRNISEKVQEVLKKGMIPIVLGGEHSITYGVVKTF
DLSDVTILHFDAHMDMANTYAGKKFSHATVMRRIYELHPKKIVQIGVRSCTKEEHEFVLN
ENIKYYTSRDIIEKFNMVLNEINKLDGPFYVTVDIDVLDPGYAPGVGNPTPVGITPYHME
KFIEKIARKKIIGIDIVEVATDRIGDPAAMNAAKILYDFLFAIKI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggtctaaaatttgcatattctaaggacccttcctcccttaaatacctttctaataaa
aaagtttttggattgttaggagtaccttttgatagcacatccacatataagccagggtca
agatttggaccattgatgattcgtcaagcatcctacaattttgaaaactatagtttacac
tatagaaaaaaactagatgttcctatcattgatttaggtgatattgaggtaattctaggt
gactttaaaaatacttgtcgtaatatttctgaaaaagttcaagaagttttaaaaaaagga
atgattcctattgtccttggtggagaacatagcataacatatggtgttgtgaaaacattt
gatctaagtgatgtaactattctacactttgatgcacatatggatatggcaaatacttat
gctggtaaaaagttttcgcatgcaacagtcatgcgacgaatatatgaattacatccgaag
aaaattgtccaaattggtgtaagatcttgtacaaaagaagaacatgaatttgttcttaat
gaaaatatcaaatactatacatcaagagacataattgaaaaatttaacatggttttaaat
gaaataaataaattagatggaccattctatgtaacagtggatatagatgtattagatcct
ggttatgctccaggtgttggaaatccaacgcctgtaggtatcactccctaccatatggaa
aaattcattgaaaaaatagctagaaaaaaaattattggcattgacattgttgaagttgca
acagatagaataggcgaccccgcagcgatgaatgcagcaaaaattttgtatgatttttta
tttgcaataaaaatataa

DBGET integrated database retrieval system