KEGG   Methanothermus fervidus: Mfer_1275Help
Entry
Mfer_1275         CDS       T01351                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfv  Methanothermus fervidus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mfer_1275
   00052 Galactose metabolism
    Mfer_1275
   00500 Starch and sucrose metabolism
    Mfer_1275
   00520 Amino sugar and nucleotide sugar metabolism
    Mfer_1275
Enzymes [BR:mfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mfer_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1218473..1219324
Genome map
AA seq 283 aa AA seqDB search
MKAVIPAAGLGTRLLPITKAQPKEMLPVFDKPAIQYVVEEAVAAGIDDILIITGKGKRSI
EDHFDRSFELEYFLKKNNKNEMLNEIEEISELADIYYVRQREQKGLGDAIYCARKHVDGE
TFAVLLGDTITYSKTPCIKKLMEMYKIYKSSIVAVEEVPRKKVSRYGIIKGKELKKNIYL
VEDMVEKPKIEEAPSNLAIIGRYILEPEIFDCIKETGPGVGGEIQLTDAMRLLDRVYAYK
FSGKTYDIGNKIDWLKTSIEFALREKDIKEKLKPWLSKIIKQN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtgatacctgcggcgggattaggtactagacttttaccaattactaaagcg
cagccaaaggaaatgttacctgtttttgataaaccggctattcaatatgttgtagaggag
gctgtggcagcaggaattgatgatatacttataataactggtaaaggtaaaagatcaata
gaagatcattttgatagatcttttgaattagaatattttttaaaaaagaataataaaaat
gagatgcttaatgaaattgaagaaatttcagaattagctgatatttattatgtaagacaa
agagaacaaaaaggattaggggatgctatatattgtgcgcgtaagcatgttgatggagaa
acatttgctgtattgttgggagatacaataacatattctaagacaccatgcattaaaaaa
ttaatggagatgtataagatatacaaatccagtattgtagctgttgaagaggttccaaga
aaaaaagtaagtaggtatggaataataaagggaaaagaattgaaaaaaaatatttatttg
gttgaagacatggttgaaaaacctaaaattgaggaagcaccgtcaaacctagctataatt
ggtagatatatccttgaaccagaaatatttgattgtataaaagaaacaggtccaggagtt
ggtggtgaaatacaactaacagatgcaatgagattgctagatagagtatatgcttacaag
ttttctgggaaaacatatgatattggaaataaaatagattggctaaaaacttctatagaa
tttgcacttagagaaaaagatattaaagaaaaactaaaaccttggctttcaaaaattatt
aaacaaaactaa

DBGET integrated database retrieval system