KEGG   Methanothermus fervidus: Mfer_1298Help
Entry
Mfer_1298         CDS       T01351                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfv  Methanothermus fervidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mfv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237603..1238391)
Genome map
AA seq 262 aa AA seqDB search
MEMKNKIIAVTRPKDRAQEAVDIIEKHGGKALVVPTLELKKLCTESLMKICKIADKLDWV
IFTSPFAVDALLECCPQFPKKLNKNAKIAVIGPKTKKTVIEKGLKVDVEPPEYVTESLIE
TLKNYDMKDKNVAIPRTKAARKTLIKSLEEMGANVYVAEAYKSTLPKDVSKIKKLINKII
NNEIDAITFTSPLTVKNLFKVAGNKKDEVIKVLSSKKVLAAAIGPITANTLFEYAIVPII
PHKYTVREMILEIFREFRRMED
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaagaataaaattattgccgtcactagacctaaagatagagctcaggaagct
gttgatattattgaaaagcatggtggcaaggcattagttgtgcctactttagaattaaaa
aagctttgtacagaatcactcatgaaaatttgtaaaattgctgataaacttgattgggta
attttcacttctccttttgcagtggatgcacttctggaatgttgtcctcaattccctaaa
aaattaaataaaaatgcaaaaatagcggttataggtccaaaaacaaaaaaaacagttatt
gaaaaaggcttaaaagtagatgttgaaccaccagaatatgttactgaaagtcttatagaa
actctcaaaaattatgatatgaaagataaaaacgttgctataccgcgcactaaagcagca
agaaaaacattgattaaatcattggaagaaatgggagcaaatgtttatgttgcagaagct
tataaatcaactctacctaaagatgtttccaagataaaaaagttaataaataaaataata
aacaatgaaatagatgcaataacttttacaagtccattaacagttaaaaacttatttaaa
gttgcaggaaataaaaaagatgaagtcataaaagttttatctagtaaaaaggttttagct
gctgcaataggacccataacagctaatacattatttgaatatgcgatagtacctataatt
cctcataaatatacagtgcgtgaaatgatattagaaatatttagggaattcaggaggatg
gaagattga

DBGET integrated database retrieval system