KEGG   Methanothermus fervidus: Mfer_1298Help
Entry
Mfer_1298         CDS       T01351                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfv  Methanothermus fervidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mfer_1298
Enzymes [BR:mfv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mfer_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237603..1238391)
Genome map
AA seq 262 aa AA seqDB search
MEMKNKIIAVTRPKDRAQEAVDIIEKHGGKALVVPTLELKKLCTESLMKICKIADKLDWV
IFTSPFAVDALLECCPQFPKKLNKNAKIAVIGPKTKKTVIEKGLKVDVEPPEYVTESLIE
TLKNYDMKDKNVAIPRTKAARKTLIKSLEEMGANVYVAEAYKSTLPKDVSKIKKLINKII
NNEIDAITFTSPLTVKNLFKVAGNKKDEVIKVLSSKKVLAAAIGPITANTLFEYAIVPII
PHKYTVREMILEIFREFRRMED
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaagaataaaattattgccgtcactagacctaaagatagagctcaggaagct
gttgatattattgaaaagcatggtggcaaggcattagttgtgcctactttagaattaaaa
aagctttgtacagaatcactcatgaaaatttgtaaaattgctgataaacttgattgggta
attttcacttctccttttgcagtggatgcacttctggaatgttgtcctcaattccctaaa
aaattaaataaaaatgcaaaaatagcggttataggtccaaaaacaaaaaaaacagttatt
gaaaaaggcttaaaagtagatgttgaaccaccagaatatgttactgaaagtcttatagaa
actctcaaaaattatgatatgaaagataaaaacgttgctataccgcgcactaaagcagca
agaaaaacattgattaaatcattggaagaaatgggagcaaatgtttatgttgcagaagct
tataaatcaactctacctaaagatgtttccaagataaaaaagttaataaataaaataata
aacaatgaaatagatgcaataacttttacaagtccattaacagttaaaaacttatttaaa
gttgcaggaaataaaaaagatgaagtcataaaagttttatctagtaaaaaggttttagct
gctgcaataggacccataacagctaatacattatttgaatatgcgatagtacctataatt
cctcataaatatacagtgcgtgaaatgatattagaaatatttagggaattcaggaggatg
gaagattga

DBGET integrated database retrieval system