KEGG   Mycoplasma gallisepticum R(low): MGA_0357Help
Entry
MGA_0357          CDS       T00131                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mga  Mycoplasma gallisepticum R(low)
Pathway
mga00010  Glycolysis / Gluconeogenesis
mga00051  Fructose and mannose metabolism
mga01100  Metabolic pathways
mga01110  Biosynthesis of secondary metabolites
mga01120  Microbial metabolism in diverse environments
mga01130  Biosynthesis of antibiotics
mga01200  Carbon metabolism
mga01230  Biosynthesis of amino acids
Module
mga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGA_0357 (tpiA)
   00051 Fructose and mannose metabolism
    MGA_0357 (tpiA)
   00562 Inositol phosphate metabolism
    MGA_0357 (tpiA)
Enzymes [BR:mga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGA_0357 (tpiA)
Exosome [BR:mga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGA_0357 (tpiA)
  Exosomal proteins of bladder cancer cells
   MGA_0357 (tpiA)
  Exosomal proteins of melanoma cells
   MGA_0357 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: AAP56931
UniProt: Q7NAQ4
Position
complement(808902..809660)
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLERNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattagaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system