KEGG   Mycoplasma gallisepticum R(low): MGA_0407Help
Entry
MGA_0407          CDS       T00131                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mga  Mycoplasma gallisepticum R(low)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mga03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847891..848571)
Genome map
AA seq 226 aa AA seqDB search
MITSVYAKIEYVTNTKMLFVANNWGYWVNVKPNSGFSRTDNNVLVFLHELTFLAQNNAIN
KELYAFKSLKEKEWFKALLTINGIGPKTAMNVMVNKQEEVLTLIKNNDLNGLLRLENINK
KVATMLLASDIASKHYLKNQIVVSDKVEPQIDDDEKIDDSKDLNDDELLSEIVIEAIDCL
ISLGYKQEQIKTALAEIDLKNESINDSADLVAVIIKQIGLRTSEVS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcacttctgtatacgcaaaaatagaatatgtgacaaacacaaagatgttgtttgtt
gccaataactgaggttattgggtaaatgtaaaaccaaatagtggttttagtcgcactgac
aataatgttcttgttttcttacacgaactaacctttttagcacagaacaatgctattaat
aaagaactatatgcttttaagagtttaaaagaaaaagaatggttcaaggcactgttaacg
atcaatggcattggccctaaaacagccatgaacgtaatggtaaataaacaagaagaggta
ctaaccttaattaaaaacaatgacttaaacggcttgttaagattagaaaacattaataag
aaagttgccacaatgttgttagcttcagatattgctagtaagcactatctgaagaaccaa
attgttgttagcgataaagttgaaccacaaatagatgacgatgagaaaattgatgatagc
aaagacctaaatgatgatgaattattatcagagatcgtgattgaagcaattgattgttta
atcagtctaggatataaacaagagcaaataaaaacggcgttagctgaaattgatttaaaa
aacgaatcaattaatgattcggctgatcttgtggcagtaatcattaaacaaataggctta
agaacaagtgaagttagctag

DBGET integrated database retrieval system