KEGG   Mycoplasma gallisepticum R(low): MGA_0635Help
Entry
MGA_0635          CDS       T00131                                 

Gene name
ispE
Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mga  Mycoplasma gallisepticum R(low)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mga00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGA_0635 (ispE)
Enzymes [BR:mga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MGA_0635 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10801..11586
Genome map
AA seq 261 aa AA seqDB search
MVLKKHPELKSYHLPNCLAYMNHYRSYAKVNFYLKIKEYCPKVKKHKLESKLVLVKDLYD
DLYLEKWNQTKIKYFDQNNNSLTFSDDILVRTKKFLEDKLNQTFEFKAKVIKRIPTLSGL
GSAPSNAAVLINWIYQEFGILNPVSYYEIATELGSDIPFFLSLHDCAIIKNFGDQVEQSI
LDGYETEKIIFNKQKPSTKKIFELLDYSQIKKENLNDLEQPFFSLFPELLPSFNQLKNDS
NHVVLAGAGSCFVVFRKLNEI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggttttaaaaaaacatccagagctcaagagttatcacctacccaactgtttagcttat
atgaatcattatcgaagttatgctaaagttaatttttatctaaaaattaaggaatactgt
ccaaaagttaaaaagcataaacttgagtccaagttagttcttgttaaagatctttatgat
gatctttatttagaaaaatggaaccaaactaagattaagtattttgatcaaaataacaac
tctttaacttttagtgatgatattttagttaggactaaaaaatttttagaagataagtta
aatcaaacttttgaatttaaagcgaaggtgattaaaagaattccgaccctttctggactt
ggctcagctccaagtaatgctgctgttttgattaattgaatttaccaagaatttggaatc
cttaacccggttagttattatgaaatagctactgaactaggtagtgatattccctttttc
ttatccttacacgattgtgcaattattaagaattttggggatcaagtagagcaatctatt
ttggatgggtatgaaacagaaaagatcatttttaacaaacaaaaacctagcacaaaaaag
atctttgaactcttagattattctcaaattaaaaaagaaaatcttaatgatttagaacaa
ccgttttttagtttatttcccgaattattaccttcttttaaccaattaaaaaatgacagc
aatcacgttgtgttagcaggagctggaagctgctttgtcgtatttagaaagctaaatgaa
atataa

DBGET integrated database retrieval system