KEGG   Mycoplasma gallisepticum CA06_2006.052-5-2P: HFMG06CAA_3714Help
Entry
HFMG06CAA_3714    CDS       T02326                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgac  Mycoplasma gallisepticum CA06_2006.052-5-2P
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFMG06CAA_3714 (pfkA)
   01230 Biosynthesis of amino acids
    HFMG06CAA_3714 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG06CAA_3714 (pfkA)
   00030 Pentose phosphate pathway
    HFMG06CAA_3714 (pfkA)
   00051 Fructose and mannose metabolism
    HFMG06CAA_3714 (pfkA)
   00052 Galactose metabolism
    HFMG06CAA_3714 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HFMG06CAA_3714 (pfkA)
Enzymes [BR:mgac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HFMG06CAA_3714 (pfkA)
Protein phosphatases and associated proteins [BR:mgac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HFMG06CAA_3714 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(634323..635321)
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIAMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITPENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcaatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgcgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgccattgtggggattta
gctgtttatgcagcacttgcaactaaagctgatctagtaattaccccagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcacg
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatc
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagcggtgat
gagatcgtagcttacaatttccaagaagcattaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system